Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VEN3

Protein Details
Accession A0A1D2VEN3    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-38VSGKEWKLKKDPFRINKPDTHydrophilic
93-123ERASKLSKKLNEKRLKRLQKKQKRNKLLNDRBasic
NLS Segment(s)
PositionSequence
72-119KLKKDLVIQKKKEKNLRLMEIERASKLSKKLNEKRLKRLQKKQKRNKL
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSESAILKTESILPQGPRVSGKEWKLKKDPFRINKPDTTTKNVNSSFQKRLNQRNLKKQYDLKLKELKDESKLKKDLVIQKKKEKNLRLMEIERASKLSKKLNEKRLKRLQKKQKRNKLLNDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.26
5 0.27
6 0.29
7 0.32
8 0.37
9 0.42
10 0.46
11 0.52
12 0.58
13 0.63
14 0.68
15 0.71
16 0.75
17 0.74
18 0.79
19 0.81
20 0.78
21 0.76
22 0.74
23 0.72
24 0.66
25 0.64
26 0.59
27 0.52
28 0.55
29 0.49
30 0.47
31 0.45
32 0.46
33 0.46
34 0.46
35 0.5
36 0.48
37 0.57
38 0.63
39 0.66
40 0.68
41 0.72
42 0.75
43 0.72
44 0.71
45 0.66
46 0.64
47 0.65
48 0.61
49 0.56
50 0.55
51 0.51
52 0.51
53 0.49
54 0.42
55 0.38
56 0.44
57 0.42
58 0.43
59 0.44
60 0.39
61 0.39
62 0.44
63 0.48
64 0.5
65 0.55
66 0.54
67 0.63
68 0.7
69 0.74
70 0.75
71 0.71
72 0.7
73 0.68
74 0.68
75 0.65
76 0.6
77 0.59
78 0.55
79 0.51
80 0.42
81 0.36
82 0.32
83 0.29
84 0.31
85 0.32
86 0.35
87 0.44
88 0.53
89 0.61
90 0.7
91 0.73
92 0.8
93 0.83
94 0.87
95 0.87
96 0.88
97 0.89
98 0.9
99 0.94
100 0.95
101 0.95
102 0.95
103 0.94