Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2V9W6

Protein Details
Accession A0A1D2V9W6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
101-128LASNPIKYKKKIIRKKNIENIKQKNFFSHydrophilic
NLS Segment(s)
PositionSequence
109-116KKKIIRKK
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFKSSVALMPKGIVLGRFQTLVALNARSFSSGISAFNEAPAPADAPAEQAQPQAVSYCKAGTPLNLKVYKKASSEPIAKEDSEYPDWLWKLLDQKAQAEILASNPIKYKKKIIRKKNIENIKQKNFFSKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.14
4 0.14
5 0.13
6 0.14
7 0.14
8 0.16
9 0.16
10 0.16
11 0.14
12 0.15
13 0.15
14 0.14
15 0.13
16 0.11
17 0.11
18 0.1
19 0.11
20 0.12
21 0.14
22 0.13
23 0.14
24 0.14
25 0.11
26 0.12
27 0.11
28 0.1
29 0.08
30 0.08
31 0.07
32 0.1
33 0.11
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.1
47 0.1
48 0.11
49 0.15
50 0.17
51 0.23
52 0.27
53 0.27
54 0.29
55 0.32
56 0.33
57 0.3
58 0.29
59 0.27
60 0.28
61 0.33
62 0.31
63 0.32
64 0.3
65 0.29
66 0.28
67 0.26
68 0.25
69 0.22
70 0.21
71 0.18
72 0.2
73 0.2
74 0.19
75 0.17
76 0.15
77 0.18
78 0.21
79 0.25
80 0.22
81 0.23
82 0.25
83 0.25
84 0.23
85 0.18
86 0.15
87 0.12
88 0.18
89 0.16
90 0.15
91 0.19
92 0.26
93 0.31
94 0.33
95 0.42
96 0.44
97 0.55
98 0.65
99 0.72
100 0.76
101 0.82
102 0.91
103 0.91
104 0.92
105 0.91
106 0.91
107 0.9
108 0.9
109 0.86
110 0.77