Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GCK2

Protein Details
Accession C1GCK2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-83TTTTHRSPRMHRHGLRRTRVBasic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 6, extr 5, vacu 4, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pbn:PADG_04724  -  
Amino Acid Sequences MGAVLSCIQDGLRAIGGCLMAIVNGIGNILMAIVSGIVSIFDAIISCLTCGSFRRRRSRMTMGTTTTHRSPRMHRHGLRRTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.11
5 0.1
6 0.08
7 0.05
8 0.05
9 0.05
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.05
37 0.07
38 0.16
39 0.23
40 0.31
41 0.41
42 0.45
43 0.5
44 0.57
45 0.65
46 0.65
47 0.65
48 0.64
49 0.57
50 0.58
51 0.56
52 0.53
53 0.48
54 0.44
55 0.4
56 0.38
57 0.42
58 0.5
59 0.57
60 0.62
61 0.65
62 0.71
63 0.78