FuNGI

A0A1D2VLD0

Protein Details

Accession

A0A1D2VLD0

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
475-496	EKLSAGEIKKRNKQNWGEKENA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto_nucl 11, nucl 10.5, cyto 10.5, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR000898 Indolamine_dOase IPR037217 Trp/Indoleamine_2_3_dOase-like
Gene Ontology	GO:0051213 F:dioxygenase activity GO:0020037 F:heme binding GO:0046872 F:metal ion binding GO:0019441 P:tryptophan catabolic process to kynurenine
Pfam	View protein in Pfam PF01231 IDO

Amino Acid Sequences

MDSGSFFKIPKLEDYNISPQTGFIPNEYPLERLSQDYYQPWENLMDNLPSLILSKKIRKIIDNKLPVLSTEYLSNTREFRRAYTILAFLTHAYVWAFNENPVDTLPQQISVPFVKISNVLELPPVATYASVCLWNFKPIIKDINASDKNVIKDDLDIDDICTINTFSGSIDESWFYLVSVIFEIKGGHCLSDGLNAIRCAKAHDFKNLIYCLQKLAESIDKLGSILMKMLEMCDPHTFYFRIRPFLAGWKNMKEFGLNKDGLNYGTDTKPDIRSYAGGSNAQSTLIQALDIILNVEHHPTGKRPSYNNHSLSKSLPPKPIANKNQKDDGNNFIIEMRKYMPGPHRRFLEDLSKINIIQSVVLENSKNHPELALSYDACVAMLKAFRDKHIQIVTRYIILQARLSQNGGSLSKPGSVKTLRVGLASKLTLEEKGTGGTSLLPFLKQCRDETGDSAAGSWGRRILSSGVQSLKYTTEKLSAGEIKKRNKQNWGEKENAAGHW

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.49
3	0.48
4	0.48
5	0.4
6	0.34
7	0.34
8	0.35
9	0.3
10	0.23
11	0.23
12	0.24
13	0.28
14	0.29
15	0.26
16	0.21
17	0.25
18	0.23
19	0.23
20	0.25
21	0.24
22	0.27
23	0.29
24	0.33
25	0.33
26	0.32
27	0.31
28	0.29
29	0.27
30	0.26
31	0.25
32	0.21
33	0.17
34	0.17
35	0.16
36	0.13
37	0.13
38	0.12
39	0.15
40	0.2
41	0.28
42	0.34
43	0.41
44	0.44
45	0.5
46	0.57
47	0.62
48	0.67
49	0.67
50	0.63
51	0.59
52	0.56
53	0.49
54	0.46
55	0.37
56	0.28
57	0.22
58	0.23
59	0.23
60	0.24
61	0.26
62	0.25
63	0.26
64	0.31
65	0.29
66	0.29
67	0.33
68	0.33
69	0.34
70	0.34
71	0.33
72	0.28
73	0.28
74	0.25
75	0.18
76	0.18
77	0.14
78	0.11
79	0.09
80	0.1
81	0.1
82	0.12
83	0.12
84	0.12
85	0.14
86	0.14
87	0.14
88	0.14
89	0.16
90	0.14
91	0.17
92	0.16
93	0.15
94	0.15
95	0.14
96	0.17
97	0.15
98	0.16
99	0.13
100	0.13
101	0.13
102	0.14
103	0.15
104	0.17
105	0.16
106	0.15
107	0.15
108	0.14
109	0.14
110	0.12
111	0.11
112	0.07
113	0.06
114	0.06
115	0.07
116	0.08
117	0.1
118	0.1
119	0.14
120	0.14
121	0.18
122	0.19
123	0.19
124	0.2
125	0.2
126	0.26
127	0.24
128	0.25
129	0.24
130	0.34
131	0.34
132	0.33
133	0.33
134	0.32
135	0.32
136	0.3
137	0.29
138	0.19
139	0.18
140	0.18
141	0.16
142	0.14
143	0.13
144	0.12
145	0.13
146	0.12
147	0.11
148	0.1
149	0.08
150	0.06
151	0.06
152	0.06
153	0.04
154	0.06
155	0.07
156	0.07
157	0.08
158	0.08
159	0.08
160	0.09
161	0.09
162	0.07
163	0.07
164	0.07
165	0.06
166	0.07
167	0.07
168	0.06
169	0.06
170	0.07
171	0.06
172	0.1
173	0.09
174	0.08
175	0.08
176	0.09
177	0.09
178	0.12
179	0.13
180	0.1
181	0.12
182	0.13
183	0.14
184	0.14
185	0.14
186	0.14
187	0.17
188	0.22
189	0.22
190	0.28
191	0.29
192	0.3
193	0.35
194	0.32
195	0.29
196	0.25
197	0.23
198	0.18
199	0.16
200	0.16
201	0.1
202	0.12
203	0.14
204	0.13
205	0.14
206	0.13
207	0.12
208	0.12
209	0.12
210	0.1
211	0.06
212	0.06
213	0.05
214	0.05
215	0.05
216	0.06
217	0.06
218	0.06
219	0.08
220	0.09
221	0.1
222	0.1
223	0.13
224	0.13
225	0.12
226	0.21
227	0.21
228	0.24
229	0.23
230	0.24
231	0.22
232	0.3
233	0.33
234	0.3
235	0.3
236	0.3
237	0.31
238	0.3
239	0.29
240	0.22
241	0.21
242	0.19
243	0.23
244	0.2
245	0.19
246	0.2
247	0.2
248	0.19
249	0.17
250	0.15
251	0.11
252	0.1
253	0.11
254	0.11
255	0.13
256	0.15
257	0.14
258	0.14
259	0.13
260	0.13
261	0.16
262	0.17
263	0.16
264	0.15
265	0.15
266	0.16
267	0.15
268	0.14
269	0.12
270	0.09
271	0.08
272	0.06
273	0.06
274	0.04
275	0.04
276	0.04
277	0.04
278	0.04
279	0.04
280	0.04
281	0.05
282	0.06
283	0.05
284	0.06
285	0.07
286	0.09
287	0.15
288	0.19
289	0.23
290	0.26
291	0.33
292	0.4
293	0.49
294	0.52
295	0.51
296	0.48
297	0.46
298	0.45
299	0.47
300	0.46
301	0.43
302	0.43
303	0.41
304	0.44
305	0.5
306	0.58
307	0.59
308	0.62
309	0.64
310	0.63
311	0.68
312	0.65
313	0.62
314	0.54
315	0.5
316	0.42
317	0.35
318	0.31
319	0.25
320	0.25
321	0.21
322	0.2
323	0.16
324	0.15
325	0.15
326	0.2
327	0.28
328	0.35
329	0.41
330	0.45
331	0.47
332	0.47
333	0.49
334	0.47
335	0.47
336	0.42
337	0.39
338	0.37
339	0.35
340	0.32
341	0.3
342	0.29
343	0.19
344	0.14
345	0.12
346	0.1
347	0.1
348	0.11
349	0.11
350	0.11
351	0.15
352	0.18
353	0.18
354	0.16
355	0.16
356	0.15
357	0.16
358	0.19
359	0.19
360	0.15
361	0.16
362	0.17
363	0.16
364	0.15
365	0.14
366	0.1
367	0.08
368	0.1
369	0.1
370	0.16
371	0.17
372	0.19
373	0.26
374	0.27
375	0.32
376	0.38
377	0.41
378	0.37
379	0.42
380	0.41
381	0.36
382	0.35
383	0.3
384	0.25
385	0.22
386	0.22
387	0.21
388	0.23
389	0.23
390	0.24
391	0.21
392	0.21
393	0.23
394	0.23
395	0.18
396	0.16
397	0.16
398	0.2
399	0.2
400	0.19
401	0.22
402	0.23
403	0.24
404	0.26
405	0.31
406	0.27
407	0.29
408	0.3
409	0.26
410	0.29
411	0.27
412	0.23
413	0.19
414	0.2
415	0.19
416	0.19
417	0.18
418	0.14
419	0.15
420	0.15
421	0.13
422	0.12
423	0.13
424	0.12
425	0.14
426	0.14
427	0.14
428	0.14
429	0.18
430	0.26
431	0.26
432	0.27
433	0.31
434	0.35
435	0.37
436	0.39
437	0.41
438	0.36
439	0.33
440	0.32
441	0.26
442	0.23
443	0.21
444	0.19
445	0.16
446	0.14
447	0.14
448	0.16
449	0.17
450	0.22
451	0.25
452	0.3
453	0.32
454	0.33
455	0.33
456	0.32
457	0.34
458	0.3
459	0.28
460	0.24
461	0.25
462	0.24
463	0.25
464	0.31
465	0.35
466	0.38
467	0.45
468	0.5
469	0.55
470	0.63
471	0.72
472	0.71
473	0.73
474	0.78
475	0.8
476	0.83
477	0.81
478	0.78
479	0.7
480	0.7

A0A1D2VLD0

3D AlphaFold-predicted Structure Viewer