Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VG44

Protein Details
Accession A0A1D2VG44    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MCPCERYKKPRSESRTRKSKPAREGSHydrophilic
NLS Segment(s)
PositionSequence
8-22KKPRSESRTRKSKPA
Subcellular Location(s) nucl 12, cyto_nucl 9.5, mito 7, cyto 3, plas 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCPCERYKKPRSESRTRKSKPAREGSGETSSNSSSSEQSQQIIAVFRAVFTAVFTAVFTAVLTLPQRKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.8
4 0.82
5 0.82
6 0.82
7 0.8
8 0.79
9 0.75
10 0.69
11 0.7
12 0.65
13 0.61
14 0.53
15 0.43
16 0.35
17 0.29
18 0.23
19 0.2
20 0.16
21 0.1
22 0.11
23 0.14
24 0.13
25 0.14
26 0.14
27 0.13
28 0.13
29 0.13
30 0.12
31 0.1
32 0.09
33 0.08
34 0.08
35 0.08
36 0.07
37 0.06
38 0.07
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.09
49 0.12
50 0.16