Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VLZ1

Protein Details
Accession A0A1D2VLZ1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-51TEYKSEKRSNKWKFRFTKRCPNCYIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031127  E3_UB_ligase_RBR  
IPR044066  TRIAD_supradom  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0016567  P:protein ubiquitination  
PROSITE View protein in PROSITE  
PS51873  TRIAD  
Amino Acid Sequences YVSCESNHIFCFKCGEKDHRPSSCFSTEYKSEKRSNKWKFRFTKRCPNCYIVIEKTGGCSQMKCPSCQVKFDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.46
4 0.53
5 0.61
6 0.6
7 0.6
8 0.56
9 0.56
10 0.52
11 0.44
12 0.36
13 0.33
14 0.32
15 0.37
16 0.39
17 0.39
18 0.43
19 0.47
20 0.54
21 0.59
22 0.64
23 0.68
24 0.71
25 0.75
26 0.76
27 0.82
28 0.85
29 0.82
30 0.83
31 0.81
32 0.81
33 0.76
34 0.71
35 0.63
36 0.56
37 0.55
38 0.46
39 0.4
40 0.34
41 0.29
42 0.29
43 0.26
44 0.25
45 0.19
46 0.18
47 0.19
48 0.27
49 0.3
50 0.29
51 0.35
52 0.43
53 0.45