Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VE76

Protein Details
Accession A0A1D2VE76   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-67PSACSACRKRKVKCDKKRPYCTSCLKNNHydrophilic
NLS Segment(s)
PositionSequence
33-36KKKR
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MASSAAASAASASSAASAAPKRPSCDNGESRIKKKRQRIPSACSACRKRKVKCDKKRPYCTSCLKNNIIHLCNYMEPTWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.07
4 0.09
5 0.12
6 0.2
7 0.22
8 0.24
9 0.28
10 0.31
11 0.35
12 0.42
13 0.42
14 0.42
15 0.51
16 0.53
17 0.56
18 0.62
19 0.63
20 0.62
21 0.67
22 0.69
23 0.69
24 0.75
25 0.76
26 0.73
27 0.76
28 0.77
29 0.71
30 0.7
31 0.67
32 0.64
33 0.66
34 0.67
35 0.63
36 0.65
37 0.73
38 0.76
39 0.79
40 0.82
41 0.84
42 0.88
43 0.94
44 0.92
45 0.87
46 0.86
47 0.84
48 0.81
49 0.79
50 0.76
51 0.7
52 0.65
53 0.66
54 0.65
55 0.57
56 0.5
57 0.43
58 0.38
59 0.35
60 0.34