Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VHY1

Protein Details
Accession A0A1D2VHY1    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-31YENFFKEIKLRKNRKEIPMIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 9.5, mito 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007967  GSKIP_dom  
IPR023231  GSKIP_dom_sf  
Pfam View protein in Pfam  
PF05303  GSKIP_dom  
Amino Acid Sequences MNELNQMIAEYENFFKEIKLRKNRKEIPMIESNIVFIDSVNSNTKNNFKNNTENKKNDAVEYLNIKTFENNEYNVFFNSSGWYAKQVSPITMYLDRKYETFEALFMNLSKKFAETWHKELSKKLLALPNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.19
4 0.27
5 0.34
6 0.44
7 0.53
8 0.61
9 0.72
10 0.8
11 0.81
12 0.82
13 0.75
14 0.71
15 0.69
16 0.64
17 0.55
18 0.46
19 0.38
20 0.29
21 0.25
22 0.18
23 0.1
24 0.09
25 0.08
26 0.1
27 0.13
28 0.14
29 0.15
30 0.17
31 0.23
32 0.25
33 0.29
34 0.32
35 0.32
36 0.41
37 0.51
38 0.59
39 0.61
40 0.6
41 0.59
42 0.6
43 0.57
44 0.47
45 0.4
46 0.31
47 0.25
48 0.26
49 0.23
50 0.18
51 0.18
52 0.17
53 0.15
54 0.15
55 0.15
56 0.13
57 0.14
58 0.13
59 0.14
60 0.15
61 0.15
62 0.15
63 0.12
64 0.11
65 0.11
66 0.11
67 0.1
68 0.09
69 0.12
70 0.13
71 0.14
72 0.2
73 0.19
74 0.19
75 0.21
76 0.21
77 0.23
78 0.26
79 0.27
80 0.23
81 0.25
82 0.25
83 0.23
84 0.26
85 0.23
86 0.2
87 0.17
88 0.17
89 0.15
90 0.15
91 0.16
92 0.13
93 0.16
94 0.14
95 0.15
96 0.14
97 0.13
98 0.14
99 0.18
100 0.27
101 0.31
102 0.36
103 0.45
104 0.5
105 0.51
106 0.55
107 0.57
108 0.54
109 0.49
110 0.49