Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VM04

Protein Details
Accession A0A1D2VM04    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-117YSQNKNQKKQDQQQQHHHQDQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 4.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008816  Gly_zipper_2TM_dom  
Gene Ontology GO:0019867  C:outer membrane  
Pfam View protein in Pfam  
PF05433  Rick_17kDa_Anti  
Amino Acid Sequences MSASSFYGSGGPPDSSSNRENNRENNNQNYNQNQNQNQPPAEGEEGERGFLATVVGGAAGAYGGGKISGSHSTLGKIGGAIAGSFFANKIEDKWEEYSQNKNQKKQDQQQQHHHQDQYGGGYGGPPQGPPGGYGGPGGYGGYGGPPGPPGYSGYSNQGPGRWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.26
4 0.33
5 0.37
6 0.44
7 0.48
8 0.52
9 0.58
10 0.63
11 0.65
12 0.66
13 0.66
14 0.64
15 0.64
16 0.62
17 0.61
18 0.58
19 0.6
20 0.54
21 0.54
22 0.56
23 0.56
24 0.5
25 0.44
26 0.38
27 0.34
28 0.31
29 0.24
30 0.19
31 0.2
32 0.19
33 0.18
34 0.17
35 0.13
36 0.12
37 0.11
38 0.1
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.04
55 0.06
56 0.07
57 0.08
58 0.09
59 0.1
60 0.1
61 0.1
62 0.09
63 0.07
64 0.06
65 0.05
66 0.05
67 0.04
68 0.03
69 0.04
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.06
77 0.08
78 0.09
79 0.12
80 0.16
81 0.18
82 0.21
83 0.23
84 0.3
85 0.34
86 0.44
87 0.46
88 0.49
89 0.54
90 0.59
91 0.67
92 0.69
93 0.71
94 0.72
95 0.76
96 0.8
97 0.83
98 0.83
99 0.79
100 0.71
101 0.62
102 0.53
103 0.46
104 0.37
105 0.28
106 0.2
107 0.13
108 0.13
109 0.13
110 0.13
111 0.12
112 0.1
113 0.09
114 0.11
115 0.11
116 0.11
117 0.14
118 0.12
119 0.12
120 0.13
121 0.12
122 0.1
123 0.1
124 0.1
125 0.06
126 0.05
127 0.05
128 0.05
129 0.06
130 0.05
131 0.05
132 0.07
133 0.08
134 0.08
135 0.09
136 0.11
137 0.17
138 0.21
139 0.22
140 0.27
141 0.3
142 0.34
143 0.34