Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VK62

Protein Details
Accession A0A1D2VK62   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21ACDICRKRKTKCFGGVPCNYCHydrophilic
26-53LECTFHAHQNKRKRKRRTVIKHGANPNIHydrophilic
NLS Segment(s)
PositionSequence
36-43KRKRKRRT
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences ACDICRKRKTKCFGGVPCNYCLNSKLECTFHAHQNKRKRKRRTVIKHGANPNISILEKRLTSMELLIEKLVKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.74
4 0.69
5 0.62
6 0.53
7 0.44
8 0.37
9 0.3
10 0.23
11 0.22
12 0.22
13 0.2
14 0.2
15 0.26
16 0.27
17 0.32
18 0.39
19 0.43
20 0.48
21 0.57
22 0.67
23 0.71
24 0.78
25 0.8
26 0.81
27 0.85
28 0.89
29 0.89
30 0.9
31 0.9
32 0.9
33 0.88
34 0.84
35 0.8
36 0.7
37 0.59
38 0.49
39 0.41
40 0.32
41 0.24
42 0.19
43 0.16
44 0.15
45 0.16
46 0.16
47 0.14
48 0.14
49 0.15
50 0.17
51 0.15
52 0.16
53 0.16