Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VFR8

Protein Details
Accession A0A1D2VFR8    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KKPKRHNKRKPNPIDPLSVTBasic
79-98KELPNRKPKDCRKRWSNSLDHydrophilic
NLS Segment(s)
PositionSequence
2-11KPKRHNKRKP
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
IPR017884  SANT_dom  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
PS51293  SANT  
CDD cd00167  SANT  
Amino Acid Sequences KKPKRHNKRKPNPIDPLSVTESLGYQTYRRESRKPWTKEEDSKLKLLLNGELYGNVILTDSLPAKSSYNDLITWDAISKELPNRKPKDCRKRWSNSLDPNLRKGKWTPEEDMLLLRAYERHGASWQKVSLEIKGRTDDQCAKRYIEVLDPSITKDRLRAWPIDEDLLLIKKVKKYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.75
3 0.7
4 0.64
5 0.54
6 0.44
7 0.33
8 0.29
9 0.22
10 0.2
11 0.15
12 0.11
13 0.15
14 0.21
15 0.28
16 0.33
17 0.37
18 0.41
19 0.52
20 0.61
21 0.63
22 0.65
23 0.66
24 0.7
25 0.74
26 0.77
27 0.76
28 0.69
29 0.65
30 0.57
31 0.49
32 0.43
33 0.35
34 0.29
35 0.2
36 0.18
37 0.16
38 0.15
39 0.14
40 0.12
41 0.1
42 0.07
43 0.05
44 0.04
45 0.04
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.09
52 0.09
53 0.11
54 0.12
55 0.13
56 0.12
57 0.13
58 0.13
59 0.13
60 0.13
61 0.11
62 0.09
63 0.08
64 0.08
65 0.08
66 0.12
67 0.18
68 0.23
69 0.32
70 0.37
71 0.42
72 0.52
73 0.61
74 0.68
75 0.7
76 0.74
77 0.75
78 0.78
79 0.81
80 0.79
81 0.77
82 0.74
83 0.74
84 0.73
85 0.66
86 0.64
87 0.61
88 0.53
89 0.46
90 0.4
91 0.39
92 0.38
93 0.4
94 0.37
95 0.35
96 0.37
97 0.35
98 0.34
99 0.26
100 0.19
101 0.15
102 0.11
103 0.09
104 0.08
105 0.11
106 0.11
107 0.11
108 0.15
109 0.19
110 0.21
111 0.25
112 0.25
113 0.22
114 0.25
115 0.25
116 0.25
117 0.3
118 0.3
119 0.28
120 0.3
121 0.32
122 0.3
123 0.35
124 0.4
125 0.37
126 0.41
127 0.41
128 0.4
129 0.38
130 0.39
131 0.35
132 0.33
133 0.3
134 0.27
135 0.27
136 0.26
137 0.28
138 0.32
139 0.31
140 0.25
141 0.25
142 0.28
143 0.33
144 0.36
145 0.36
146 0.34
147 0.4
148 0.43
149 0.42
150 0.36
151 0.29
152 0.28
153 0.27
154 0.25
155 0.21
156 0.23