Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2V881

Protein Details
Accession A0A1D2V881   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
113-140APQTKVIKTVKRKSKSKRCSFNNCSSAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
PS51039  ZF_AN1  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MKVSIKLTNSQTFTVTVPDNSTVDNLKAVAIAASPASLNFTPSTTSLYLAGRKLNIKQLVSYYSIKEGSTVLLVLKSIPIPELIAKNQAQITKQTQAMNQNKSTSLSAETSTAPQTKVIKTVKRKSKSKRCSFNNCSSAPLRIVGDCDYCKGRFCSTHRLLENHFCSGLQSCKDQLHQRNATKLHSEQTIASKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.2
4 0.2
5 0.21
6 0.2
7 0.19
8 0.2
9 0.18
10 0.17
11 0.17
12 0.14
13 0.11
14 0.11
15 0.1
16 0.09
17 0.07
18 0.07
19 0.05
20 0.06
21 0.05
22 0.05
23 0.09
24 0.09
25 0.1
26 0.1
27 0.11
28 0.12
29 0.13
30 0.17
31 0.14
32 0.15
33 0.15
34 0.17
35 0.2
36 0.2
37 0.21
38 0.19
39 0.21
40 0.23
41 0.28
42 0.3
43 0.28
44 0.27
45 0.28
46 0.28
47 0.3
48 0.29
49 0.23
50 0.21
51 0.22
52 0.2
53 0.18
54 0.16
55 0.12
56 0.11
57 0.1
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.08
69 0.1
70 0.1
71 0.14
72 0.14
73 0.16
74 0.18
75 0.18
76 0.17
77 0.18
78 0.21
79 0.2
80 0.23
81 0.23
82 0.23
83 0.31
84 0.37
85 0.37
86 0.36
87 0.33
88 0.31
89 0.31
90 0.29
91 0.21
92 0.17
93 0.13
94 0.12
95 0.13
96 0.13
97 0.12
98 0.14
99 0.14
100 0.13
101 0.14
102 0.17
103 0.16
104 0.23
105 0.27
106 0.32
107 0.4
108 0.5
109 0.57
110 0.63
111 0.71
112 0.75
113 0.81
114 0.84
115 0.85
116 0.86
117 0.85
118 0.88
119 0.87
120 0.86
121 0.82
122 0.72
123 0.66
124 0.57
125 0.5
126 0.4
127 0.34
128 0.24
129 0.17
130 0.18
131 0.16
132 0.18
133 0.16
134 0.18
135 0.19
136 0.19
137 0.21
138 0.22
139 0.23
140 0.27
141 0.31
142 0.4
143 0.42
144 0.51
145 0.52
146 0.53
147 0.54
148 0.57
149 0.55
150 0.47
151 0.42
152 0.33
153 0.31
154 0.3
155 0.31
156 0.23
157 0.23
158 0.23
159 0.26
160 0.32
161 0.4
162 0.45
163 0.5
164 0.57
165 0.6
166 0.66
167 0.66
168 0.64
169 0.61
170 0.55
171 0.49
172 0.43
173 0.39
174 0.34