Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VQR1

Protein Details
Accession A0A1D2VQR1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-69NCMQHYRTHLNPKNKSRKKKTLKHydrophilic
NLS Segment(s)
PositionSequence
59-69KNKSRKKKTLK
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences RKYKCKICEKSFTTSGHLARHSRIHTGERKHVCPYPGCDSRFARQDNCMQHYRTHLNPKNKSRKKKTLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.44
4 0.44
5 0.38
6 0.35
7 0.38
8 0.34
9 0.32
10 0.32
11 0.34
12 0.37
13 0.4
14 0.46
15 0.46
16 0.46
17 0.46
18 0.46
19 0.41
20 0.37
21 0.36
22 0.35
23 0.36
24 0.35
25 0.37
26 0.37
27 0.39
28 0.43
29 0.41
30 0.35
31 0.32
32 0.37
33 0.39
34 0.41
35 0.42
36 0.37
37 0.37
38 0.42
39 0.43
40 0.43
41 0.48
42 0.51
43 0.57
44 0.66
45 0.74
46 0.79
47 0.84
48 0.88
49 0.88