Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VPJ9

Protein Details
Accession A0A1D2VPJ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVLKPKKPNSAQRKCCRVRLTNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MVLKPKKPNSAQRKCCRVRLTNGKIVSAYIPGEGHNAQEHSVVLIRGGRCQDVPGVKYHAVRGALDLNGVANRISSRSKYGVKKPQKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.81
4 0.77
5 0.76
6 0.76
7 0.74
8 0.71
9 0.67
10 0.6
11 0.52
12 0.46
13 0.36
14 0.26
15 0.18
16 0.11
17 0.1
18 0.09
19 0.11
20 0.11
21 0.11
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.08
28 0.09
29 0.08
30 0.07
31 0.09
32 0.09
33 0.1
34 0.11
35 0.11
36 0.1
37 0.11
38 0.14
39 0.14
40 0.15
41 0.16
42 0.2
43 0.21
44 0.22
45 0.22
46 0.23
47 0.21
48 0.2
49 0.2
50 0.18
51 0.16
52 0.15
53 0.14
54 0.11
55 0.1
56 0.1
57 0.08
58 0.06
59 0.07
60 0.1
61 0.13
62 0.14
63 0.19
64 0.25
65 0.33
66 0.41
67 0.51
68 0.59