Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2V8P3

Protein Details
Accession A0A1D2V8P3   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-39SRQHVEVKNRKGRKEKLPLYBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR014756  Ig_E-set  
IPR028934  Vps26-related  
Gene Ontology GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF03643  Vps26  
Amino Acid Sequences MSLFFKSPIDIEVRLDNEDSRQHVEVKNRKGRKEKLPLYEDGESVKGQVTIRLRNNNKLDHLGIKIQLIGTIETHSNSSSNNNASNSNNSNLTLNNNNDNFLYLLQELSAPATLNHPENYHFEFKNVEKQFESYRGLNVNLRYYLKCIVLRKNSSNIIREKELWVYNHQFPPDSPSSVKMDVGIEDCLHIEFEYSKSRYSLKDVIVGRIYFLLVRLKIKHMELSLIKRESIGTPPNQFSNSETLVRFEIMDGAPVRGEAIPIRLFLGGFDLTPTFRDVNKKFSVRTFLSLVLIDEDSRRYFKQSEIILYRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.24
4 0.23
5 0.26
6 0.27
7 0.26
8 0.26
9 0.28
10 0.32
11 0.41
12 0.47
13 0.54
14 0.61
15 0.63
16 0.7
17 0.75
18 0.79
19 0.8
20 0.82
21 0.8
22 0.79
23 0.77
24 0.73
25 0.7
26 0.64
27 0.54
28 0.45
29 0.38
30 0.28
31 0.24
32 0.2
33 0.16
34 0.14
35 0.18
36 0.21
37 0.27
38 0.34
39 0.44
40 0.47
41 0.54
42 0.59
43 0.59
44 0.58
45 0.53
46 0.49
47 0.42
48 0.41
49 0.35
50 0.31
51 0.27
52 0.24
53 0.2
54 0.18
55 0.16
56 0.13
57 0.11
58 0.11
59 0.12
60 0.11
61 0.12
62 0.11
63 0.1
64 0.1
65 0.13
66 0.15
67 0.17
68 0.2
69 0.2
70 0.22
71 0.24
72 0.29
73 0.29
74 0.28
75 0.26
76 0.23
77 0.23
78 0.21
79 0.23
80 0.23
81 0.22
82 0.26
83 0.25
84 0.26
85 0.25
86 0.25
87 0.21
88 0.16
89 0.16
90 0.09
91 0.09
92 0.08
93 0.08
94 0.07
95 0.07
96 0.07
97 0.05
98 0.06
99 0.08
100 0.09
101 0.11
102 0.12
103 0.12
104 0.13
105 0.17
106 0.21
107 0.24
108 0.22
109 0.21
110 0.23
111 0.24
112 0.32
113 0.3
114 0.27
115 0.23
116 0.25
117 0.26
118 0.27
119 0.29
120 0.2
121 0.21
122 0.21
123 0.22
124 0.23
125 0.22
126 0.2
127 0.19
128 0.2
129 0.18
130 0.18
131 0.19
132 0.19
133 0.21
134 0.22
135 0.27
136 0.32
137 0.36
138 0.37
139 0.39
140 0.42
141 0.41
142 0.43
143 0.39
144 0.35
145 0.33
146 0.31
147 0.29
148 0.27
149 0.26
150 0.23
151 0.24
152 0.25
153 0.28
154 0.29
155 0.28
156 0.24
157 0.22
158 0.27
159 0.25
160 0.23
161 0.19
162 0.19
163 0.23
164 0.23
165 0.23
166 0.17
167 0.15
168 0.14
169 0.14
170 0.12
171 0.09
172 0.08
173 0.08
174 0.07
175 0.07
176 0.06
177 0.05
178 0.05
179 0.08
180 0.14
181 0.15
182 0.15
183 0.16
184 0.19
185 0.19
186 0.24
187 0.28
188 0.23
189 0.29
190 0.29
191 0.31
192 0.33
193 0.31
194 0.26
195 0.21
196 0.2
197 0.13
198 0.13
199 0.14
200 0.12
201 0.15
202 0.16
203 0.19
204 0.22
205 0.23
206 0.24
207 0.21
208 0.25
209 0.26
210 0.31
211 0.35
212 0.34
213 0.33
214 0.3
215 0.31
216 0.27
217 0.27
218 0.27
219 0.24
220 0.28
221 0.3
222 0.32
223 0.32
224 0.31
225 0.28
226 0.28
227 0.26
228 0.25
229 0.23
230 0.23
231 0.23
232 0.22
233 0.2
234 0.15
235 0.15
236 0.12
237 0.16
238 0.14
239 0.14
240 0.13
241 0.13
242 0.14
243 0.11
244 0.12
245 0.08
246 0.12
247 0.12
248 0.13
249 0.14
250 0.13
251 0.13
252 0.12
253 0.15
254 0.11
255 0.1
256 0.11
257 0.11
258 0.11
259 0.12
260 0.15
261 0.13
262 0.16
263 0.25
264 0.26
265 0.33
266 0.41
267 0.45
268 0.45
269 0.48
270 0.54
271 0.48
272 0.5
273 0.45
274 0.39
275 0.37
276 0.34
277 0.3
278 0.24
279 0.22
280 0.18
281 0.16
282 0.17
283 0.18
284 0.21
285 0.21
286 0.23
287 0.24
288 0.27
289 0.33
290 0.35
291 0.42