Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VS67

Protein Details
Accession A0A1D2VS67   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-42LWKFPLKLSRTRKYRQRKRLQAVDNVLHydrophilic
80-105KYTVYSKKTRGYRKGIHRVPKWTKVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 4, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKATNVALGGLLWKFPLKLSRTRKYRQRKRLQAVDNVLSVVTEGLVKTEQIVPKKLQQLNNSEFFPKEHEMLPRDKYTVYSKKTRGYRKGIHRVPKWTKVSQRVNPKYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.08
6 0.1
7 0.17
8 0.18
9 0.28
10 0.37
11 0.46
12 0.54
13 0.62
14 0.71
15 0.75
16 0.83
17 0.84
18 0.86
19 0.87
20 0.88
21 0.9
22 0.85
23 0.82
24 0.77
25 0.69
26 0.58
27 0.47
28 0.37
29 0.27
30 0.21
31 0.13
32 0.06
33 0.04
34 0.03
35 0.04
36 0.04
37 0.04
38 0.05
39 0.09
40 0.12
41 0.13
42 0.16
43 0.17
44 0.22
45 0.3
46 0.33
47 0.35
48 0.37
49 0.43
50 0.44
51 0.46
52 0.42
53 0.35
54 0.31
55 0.27
56 0.27
57 0.21
58 0.18
59 0.17
60 0.21
61 0.23
62 0.27
63 0.3
64 0.28
65 0.27
66 0.26
67 0.26
68 0.31
69 0.37
70 0.37
71 0.42
72 0.45
73 0.52
74 0.6
75 0.67
76 0.67
77 0.67
78 0.72
79 0.74
80 0.8
81 0.81
82 0.82
83 0.79
84 0.81
85 0.8
86 0.81
87 0.77
88 0.74
89 0.75
90 0.75
91 0.79
92 0.77
93 0.8