Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VMA9

Protein Details
Accession A0A1D2VMA9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-40SKTVLHPKGRKLKQLNRANLRNGKHydrophilic
NLS Segment(s)
PositionSequence
21-45LHPKGRKLKQLNRANLRNGKLLAKK
Subcellular Location(s) nucl 14, mito_nucl 13.833, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MPIAKNLNKVSKSIEKSKTVLHPKGRKLKQLNRANLRNGKLLAKKSSRLNLKQSLIHRLDYIKNELNSNKLYSKKDILTHEEANALILNYINRNLTELNDLKKNRRPGRPISNRQNLLQNLLDSELTEFNKNGFHFPDLSLASNLVYIRNWNGTLGATTILNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.53
4 0.58
5 0.61
6 0.61
7 0.62
8 0.63
9 0.65
10 0.69
11 0.78
12 0.77
13 0.78
14 0.78
15 0.79
16 0.8
17 0.81
18 0.81
19 0.8
20 0.81
21 0.8
22 0.77
23 0.71
24 0.65
25 0.57
26 0.53
27 0.49
28 0.48
29 0.47
30 0.44
31 0.45
32 0.47
33 0.52
34 0.54
35 0.54
36 0.56
37 0.56
38 0.55
39 0.56
40 0.53
41 0.54
42 0.47
43 0.43
44 0.37
45 0.32
46 0.32
47 0.29
48 0.32
49 0.27
50 0.26
51 0.28
52 0.27
53 0.28
54 0.25
55 0.25
56 0.24
57 0.24
58 0.26
59 0.26
60 0.29
61 0.28
62 0.32
63 0.32
64 0.34
65 0.34
66 0.33
67 0.31
68 0.27
69 0.25
70 0.2
71 0.17
72 0.11
73 0.06
74 0.05
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.13
84 0.15
85 0.17
86 0.23
87 0.25
88 0.29
89 0.35
90 0.44
91 0.47
92 0.53
93 0.56
94 0.58
95 0.67
96 0.73
97 0.77
98 0.78
99 0.8
100 0.75
101 0.71
102 0.7
103 0.59
104 0.52
105 0.44
106 0.34
107 0.25
108 0.23
109 0.21
110 0.14
111 0.15
112 0.14
113 0.13
114 0.15
115 0.14
116 0.13
117 0.18
118 0.18
119 0.19
120 0.18
121 0.18
122 0.18
123 0.19
124 0.24
125 0.21
126 0.23
127 0.21
128 0.19
129 0.17
130 0.18
131 0.17
132 0.13
133 0.12
134 0.11
135 0.14
136 0.17
137 0.17
138 0.16
139 0.16
140 0.16
141 0.17
142 0.16
143 0.14