Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VCL0

Protein Details
Accession A0A1D2VCL0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-88ASSKTCIKSLKNHRKKVKKKTHYISLVYFHydrophilic
NLS Segment(s)
PositionSequence
70-79KNHRKKVKKK
Subcellular Location(s) mito 18, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLLADMQCACASVVNCALSRAQCTHMRLYCLCVLDAHPPYQECSHNHFRGFRSLLGRFVASSKTCIKSLKNHRKKVKKKTHYISLVYFVIIFHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.19
5 0.16
6 0.19
7 0.19
8 0.2
9 0.23
10 0.26
11 0.33
12 0.33
13 0.36
14 0.33
15 0.35
16 0.34
17 0.3
18 0.27
19 0.2
20 0.19
21 0.22
22 0.23
23 0.2
24 0.18
25 0.17
26 0.19
27 0.21
28 0.23
29 0.19
30 0.25
31 0.32
32 0.33
33 0.35
34 0.36
35 0.34
36 0.37
37 0.36
38 0.32
39 0.28
40 0.27
41 0.27
42 0.25
43 0.24
44 0.18
45 0.17
46 0.18
47 0.13
48 0.16
49 0.19
50 0.2
51 0.22
52 0.24
53 0.26
54 0.32
55 0.44
56 0.52
57 0.58
58 0.65
59 0.74
60 0.83
61 0.9
62 0.92
63 0.92
64 0.91
65 0.91
66 0.91
67 0.91
68 0.88
69 0.83
70 0.75
71 0.7
72 0.6
73 0.49
74 0.4