Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VME0

Protein Details
Accession A0A1D2VME0   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
313-333SDSDKDKKKKDSENEKIKTKQBasic
347-366LNSERVKKIKKEKEENFSNSHydrophilic
426-454NDKLSRVRGKEFNKNKNKMKRGSYRGGTIHydrophilic
NLS Segment(s)
PositionSequence
438-445NKNKNKMK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006594  LisH  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
GO:0031326  P:regulation of cellular biosynthetic process  
Pfam View protein in Pfam  
PF05022  SRP40_C  
PROSITE View protein in PROSITE  
PS50896  LISH  
Amino Acid Sequences MDETEVLALINDYFKRRKLDKLSKLLLKETNLKSSKITTPEIELEKALAKWKSESLSKKFFSCDAKLSNNEPKSESNSESDNEPKKTSLENSAKDSEMSSVKKTDSDNESDNESDSESDSESDSESDSGSDSESDSGSDSESDNEPKKTSFENSAKDSEMSSVKKTDSDNESDSESDSESDSESDSGSDSESDSGSDNSDNESDSESDSESDSESDSGSDSESDSGSDSESDNEPKKTSFENSAKDSEMSSVKKTDSDSESDSNSDSNSSSDSSSDSSSDSDSNSDSGSDSDSDSGSDSDSDSDNESDNDSDSDSDKDKKKKDSENEKIKTKQDETISKKRHSSDLLNSERVKKIKKEKEENFSNSSNDSKEISSSDNNVDYETPLKKGQRKHFSRIDSAKIVFENNVLTDNTYKGKAGTWGELANDKLSRVRGKEFNKNKNKMKRGSYRGGTITLSSGSYKFKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.35
3 0.38
4 0.47
5 0.54
6 0.62
7 0.67
8 0.74
9 0.79
10 0.78
11 0.78
12 0.74
13 0.68
14 0.62
15 0.62
16 0.55
17 0.56
18 0.52
19 0.5
20 0.46
21 0.46
22 0.48
23 0.43
24 0.43
25 0.35
26 0.37
27 0.43
28 0.44
29 0.4
30 0.33
31 0.29
32 0.28
33 0.27
34 0.28
35 0.24
36 0.22
37 0.23
38 0.26
39 0.29
40 0.34
41 0.42
42 0.43
43 0.51
44 0.52
45 0.52
46 0.5
47 0.51
48 0.5
49 0.46
50 0.44
51 0.41
52 0.45
53 0.47
54 0.51
55 0.56
56 0.52
57 0.5
58 0.47
59 0.44
60 0.44
61 0.45
62 0.42
63 0.35
64 0.34
65 0.33
66 0.33
67 0.38
68 0.38
69 0.36
70 0.35
71 0.33
72 0.32
73 0.35
74 0.34
75 0.36
76 0.38
77 0.39
78 0.44
79 0.46
80 0.44
81 0.41
82 0.38
83 0.31
84 0.28
85 0.27
86 0.23
87 0.23
88 0.23
89 0.26
90 0.26
91 0.3
92 0.29
93 0.31
94 0.32
95 0.31
96 0.33
97 0.31
98 0.3
99 0.24
100 0.2
101 0.15
102 0.13
103 0.12
104 0.1
105 0.1
106 0.1
107 0.09
108 0.1
109 0.09
110 0.09
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.09
128 0.11
129 0.15
130 0.18
131 0.19
132 0.19
133 0.19
134 0.21
135 0.22
136 0.23
137 0.28
138 0.31
139 0.34
140 0.37
141 0.39
142 0.39
143 0.36
144 0.34
145 0.28
146 0.27
147 0.25
148 0.23
149 0.23
150 0.23
151 0.26
152 0.26
153 0.3
154 0.29
155 0.31
156 0.3
157 0.29
158 0.29
159 0.27
160 0.26
161 0.2
162 0.16
163 0.12
164 0.1
165 0.1
166 0.09
167 0.09
168 0.09
169 0.08
170 0.08
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.08
189 0.09
190 0.09
191 0.09
192 0.09
193 0.09
194 0.09
195 0.1
196 0.09
197 0.09
198 0.09
199 0.09
200 0.08
201 0.08
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.08
214 0.08
215 0.08
216 0.09
217 0.11
218 0.15
219 0.18
220 0.19
221 0.19
222 0.19
223 0.21
224 0.22
225 0.23
226 0.28
227 0.31
228 0.34
229 0.37
230 0.39
231 0.39
232 0.36
233 0.34
234 0.28
235 0.27
236 0.25
237 0.23
238 0.23
239 0.23
240 0.24
241 0.24
242 0.25
243 0.21
244 0.22
245 0.23
246 0.22
247 0.22
248 0.21
249 0.21
250 0.16
251 0.14
252 0.12
253 0.09
254 0.07
255 0.08
256 0.08
257 0.08
258 0.08
259 0.09
260 0.1
261 0.1
262 0.1
263 0.1
264 0.09
265 0.1
266 0.11
267 0.1
268 0.09
269 0.09
270 0.09
271 0.09
272 0.08
273 0.07
274 0.07
275 0.08
276 0.08
277 0.08
278 0.08
279 0.08
280 0.08
281 0.08
282 0.08
283 0.07
284 0.07
285 0.07
286 0.07
287 0.08
288 0.08
289 0.09
290 0.1
291 0.1
292 0.1
293 0.11
294 0.1
295 0.1
296 0.1
297 0.09
298 0.09
299 0.09
300 0.11
301 0.13
302 0.19
303 0.25
304 0.33
305 0.38
306 0.45
307 0.52
308 0.59
309 0.67
310 0.72
311 0.76
312 0.79
313 0.81
314 0.8
315 0.78
316 0.73
317 0.7
318 0.61
319 0.56
320 0.52
321 0.55
322 0.56
323 0.61
324 0.63
325 0.6
326 0.63
327 0.6
328 0.58
329 0.53
330 0.51
331 0.5
332 0.53
333 0.55
334 0.56
335 0.55
336 0.55
337 0.56
338 0.53
339 0.49
340 0.47
341 0.52
342 0.55
343 0.63
344 0.69
345 0.72
346 0.78
347 0.82
348 0.8
349 0.75
350 0.68
351 0.59
352 0.51
353 0.45
354 0.36
355 0.28
356 0.24
357 0.19
358 0.18
359 0.18
360 0.2
361 0.2
362 0.22
363 0.23
364 0.25
365 0.24
366 0.24
367 0.23
368 0.2
369 0.23
370 0.21
371 0.21
372 0.22
373 0.29
374 0.34
375 0.43
376 0.52
377 0.58
378 0.64
379 0.7
380 0.73
381 0.73
382 0.77
383 0.74
384 0.71
385 0.65
386 0.6
387 0.54
388 0.46
389 0.41
390 0.32
391 0.26
392 0.21
393 0.15
394 0.17
395 0.14
396 0.15
397 0.15
398 0.17
399 0.18
400 0.18
401 0.18
402 0.16
403 0.17
404 0.22
405 0.23
406 0.24
407 0.24
408 0.25
409 0.26
410 0.29
411 0.29
412 0.26
413 0.24
414 0.21
415 0.22
416 0.26
417 0.3
418 0.31
419 0.36
420 0.42
421 0.48
422 0.58
423 0.65
424 0.71
425 0.76
426 0.82
427 0.85
428 0.87
429 0.9
430 0.87
431 0.87
432 0.87
433 0.85
434 0.86
435 0.81
436 0.78
437 0.71
438 0.66
439 0.57
440 0.47
441 0.4
442 0.31
443 0.27
444 0.21
445 0.2