Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VCW5

Protein Details
Accession A0A1D2VCW5   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-25NFTSSSLLRRKKDTRRGIKFSIMTHydrophilic
479-498EKEKELKKKLLQLQEQNRVYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR030379  G_SEPTIN_dom  
IPR027417  P-loop_NTPase  
IPR016491  Septin  
Gene Ontology GO:0005938  C:cell cortex  
GO:0005935  C:cellular bud neck  
GO:0032156  C:septin cytoskeleton  
GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF00735  Septin  
PROSITE View protein in PROSITE  
PS51719  G_SEPTIN  
CDD cd01850  CDC_Septin  
Amino Acid Sequences MNFTSSSLLRRKKDTRRGIKFSIMTVGASGSGRTTFINCLLGRKTIPHKFQPVGTSIEEPKTLSFTGGKGVSTINAATFEREFNPTSAHEEPGIAITEANIELIDEDSKLLLTIIDTPGFGENIDNDVCFSEIISYLQAQFDNVLAEETRVRRNPKFQDTRVHVCLYFIPATGHGLRELDVETIKKLSKYVNVIPVITRADSFTEEELKLFKENIVRDIEKFNVPVFQFTYDEEEDDPETIDENKYLQEIQPFAVICSEDTFSLNGRKVRGRKYPWGFIDIDDPHVSDFSTLKSVLLGSHLQDLKDLTHDFLYENYRTEKLKSVPGVDEYDNNRDSFIPEPPTLSSLTKIAAQRDTIIFDNPQNFNFDASADNASLKTNETPRGISSNELKPPGTPNTFNSTTLPTSVADSPNVNRSQLRVLSETVPYALSQERIRKQQQRLEELEAQSAKELAFRAAALEKKAAELKAREQKLMLQAEKEKELKKKLLQLQEQNRVYASNLTPNSDINPENVQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.83
4 0.88
5 0.85
6 0.84
7 0.75
8 0.67
9 0.62
10 0.51
11 0.41
12 0.33
13 0.27
14 0.2
15 0.17
16 0.15
17 0.1
18 0.1
19 0.1
20 0.11
21 0.12
22 0.13
23 0.15
24 0.22
25 0.21
26 0.25
27 0.27
28 0.29
29 0.29
30 0.33
31 0.4
32 0.42
33 0.49
34 0.52
35 0.57
36 0.56
37 0.59
38 0.57
39 0.51
40 0.47
41 0.42
42 0.39
43 0.35
44 0.35
45 0.32
46 0.28
47 0.26
48 0.24
49 0.22
50 0.19
51 0.17
52 0.15
53 0.2
54 0.2
55 0.19
56 0.17
57 0.17
58 0.16
59 0.16
60 0.15
61 0.11
62 0.12
63 0.12
64 0.14
65 0.14
66 0.15
67 0.16
68 0.19
69 0.2
70 0.18
71 0.21
72 0.2
73 0.25
74 0.25
75 0.25
76 0.22
77 0.2
78 0.2
79 0.19
80 0.19
81 0.13
82 0.11
83 0.09
84 0.1
85 0.09
86 0.09
87 0.07
88 0.05
89 0.05
90 0.07
91 0.07
92 0.05
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.08
101 0.1
102 0.1
103 0.1
104 0.11
105 0.12
106 0.12
107 0.11
108 0.09
109 0.07
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.09
116 0.09
117 0.08
118 0.06
119 0.07
120 0.07
121 0.08
122 0.08
123 0.09
124 0.1
125 0.1
126 0.09
127 0.08
128 0.08
129 0.08
130 0.07
131 0.08
132 0.07
133 0.08
134 0.11
135 0.13
136 0.19
137 0.23
138 0.28
139 0.31
140 0.4
141 0.47
142 0.54
143 0.61
144 0.59
145 0.65
146 0.66
147 0.7
148 0.65
149 0.59
150 0.49
151 0.4
152 0.37
153 0.31
154 0.25
155 0.17
156 0.14
157 0.12
158 0.16
159 0.15
160 0.15
161 0.11
162 0.11
163 0.11
164 0.11
165 0.11
166 0.09
167 0.1
168 0.1
169 0.1
170 0.12
171 0.12
172 0.12
173 0.12
174 0.13
175 0.16
176 0.21
177 0.25
178 0.3
179 0.31
180 0.31
181 0.3
182 0.31
183 0.27
184 0.22
185 0.18
186 0.11
187 0.11
188 0.12
189 0.13
190 0.11
191 0.14
192 0.13
193 0.13
194 0.14
195 0.13
196 0.13
197 0.12
198 0.12
199 0.13
200 0.14
201 0.17
202 0.21
203 0.21
204 0.22
205 0.24
206 0.24
207 0.21
208 0.21
209 0.17
210 0.17
211 0.16
212 0.16
213 0.15
214 0.15
215 0.14
216 0.14
217 0.19
218 0.15
219 0.15
220 0.14
221 0.14
222 0.13
223 0.12
224 0.12
225 0.07
226 0.07
227 0.07
228 0.07
229 0.06
230 0.06
231 0.06
232 0.07
233 0.07
234 0.07
235 0.09
236 0.09
237 0.09
238 0.11
239 0.11
240 0.11
241 0.11
242 0.1
243 0.08
244 0.09
245 0.09
246 0.07
247 0.07
248 0.07
249 0.08
250 0.11
251 0.14
252 0.14
253 0.16
254 0.21
255 0.25
256 0.32
257 0.39
258 0.42
259 0.49
260 0.52
261 0.58
262 0.54
263 0.54
264 0.48
265 0.4
266 0.4
267 0.31
268 0.28
269 0.21
270 0.19
271 0.15
272 0.14
273 0.14
274 0.08
275 0.08
276 0.06
277 0.08
278 0.08
279 0.08
280 0.08
281 0.08
282 0.07
283 0.09
284 0.09
285 0.08
286 0.14
287 0.15
288 0.14
289 0.15
290 0.15
291 0.13
292 0.15
293 0.15
294 0.1
295 0.1
296 0.1
297 0.1
298 0.12
299 0.15
300 0.13
301 0.15
302 0.16
303 0.18
304 0.18
305 0.2
306 0.23
307 0.21
308 0.26
309 0.26
310 0.27
311 0.27
312 0.28
313 0.3
314 0.25
315 0.28
316 0.26
317 0.29
318 0.27
319 0.26
320 0.24
321 0.2
322 0.21
323 0.18
324 0.19
325 0.18
326 0.17
327 0.19
328 0.19
329 0.2
330 0.2
331 0.19
332 0.16
333 0.13
334 0.13
335 0.16
336 0.18
337 0.19
338 0.19
339 0.19
340 0.2
341 0.2
342 0.22
343 0.19
344 0.18
345 0.17
346 0.18
347 0.23
348 0.22
349 0.22
350 0.22
351 0.21
352 0.21
353 0.19
354 0.17
355 0.13
356 0.13
357 0.15
358 0.12
359 0.12
360 0.11
361 0.12
362 0.11
363 0.12
364 0.14
365 0.16
366 0.2
367 0.21
368 0.22
369 0.24
370 0.27
371 0.26
372 0.25
373 0.28
374 0.3
375 0.33
376 0.34
377 0.32
378 0.3
379 0.34
380 0.37
381 0.36
382 0.31
383 0.31
384 0.37
385 0.38
386 0.39
387 0.36
388 0.33
389 0.3
390 0.28
391 0.26
392 0.18
393 0.19
394 0.22
395 0.21
396 0.18
397 0.2
398 0.21
399 0.27
400 0.27
401 0.26
402 0.23
403 0.24
404 0.29
405 0.3
406 0.32
407 0.27
408 0.28
409 0.29
410 0.3
411 0.28
412 0.22
413 0.19
414 0.15
415 0.15
416 0.14
417 0.14
418 0.18
419 0.26
420 0.31
421 0.39
422 0.49
423 0.55
424 0.62
425 0.65
426 0.69
427 0.69
428 0.68
429 0.67
430 0.66
431 0.58
432 0.56
433 0.51
434 0.42
435 0.34
436 0.3
437 0.22
438 0.17
439 0.17
440 0.11
441 0.11
442 0.11
443 0.13
444 0.17
445 0.2
446 0.2
447 0.22
448 0.21
449 0.23
450 0.27
451 0.26
452 0.28
453 0.29
454 0.36
455 0.43
456 0.46
457 0.44
458 0.41
459 0.45
460 0.47
461 0.52
462 0.45
463 0.41
464 0.45
465 0.48
466 0.53
467 0.53
468 0.51
469 0.5
470 0.55
471 0.57
472 0.57
473 0.63
474 0.66
475 0.7
476 0.74
477 0.77
478 0.79
479 0.82
480 0.77
481 0.69
482 0.61
483 0.51
484 0.43
485 0.4
486 0.32
487 0.3
488 0.3
489 0.32
490 0.33
491 0.33
492 0.34
493 0.31
494 0.3
495 0.24