Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VS94

Protein Details
Accession A0A1D2VS94    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
165-186LTEKRKRSKFLFKKYKCQNWKNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 9, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001708  YidC/ALB3/OXA1/COX18  
IPR028055  YidC/Oxa/ALB_C  
Gene Ontology GO:0031090  C:organelle membrane  
GO:0032977  F:membrane insertase activity  
Pfam View protein in Pfam  
PF02096  60KD_IMP  
CDD cd20069  5TM_Oxa1-like  
Amino Acid Sequences MNILFRRNVLGNTRTFALSSKNIVKQTATPNHLHNINNSKYPYNNRFQLINKRDFTLITSFAEVLPVLTQSFNNLHAYSGLPWWLFIPASTFVLRTFITLPFSISNRIRLRKQNELKPVINSMVPVFKYKLITEMLLRRKKSEKNLIPQTSLDLVSYEQILLLALTEKRKRSKFLFKKYKCQNWKNLILPTIQIPLWITLSLIIRELSGWKNILSRSTDLVSIEPTLINEGGFLWISDYSLSDPYCVFPIILGLISVTNIEWLSRYVFNNGSGQNSILGVRNSLSNRRLTVFDSITNISRLSVVFMIGISFNAPVLIVLYWICSNIYSLVQNIFLEYFLPIRYQPYNRNWTSNNFKVNDNELNKLQEMINDSKILPLVNKEKLDIDSQLEKFSIEQKQNGKELADLTKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.29
4 0.28
5 0.26
6 0.3
7 0.35
8 0.39
9 0.41
10 0.42
11 0.43
12 0.43
13 0.49
14 0.52
15 0.49
16 0.46
17 0.47
18 0.52
19 0.55
20 0.49
21 0.47
22 0.47
23 0.45
24 0.48
25 0.47
26 0.45
27 0.45
28 0.53
29 0.53
30 0.52
31 0.55
32 0.51
33 0.53
34 0.57
35 0.63
36 0.62
37 0.63
38 0.57
39 0.53
40 0.52
41 0.47
42 0.43
43 0.37
44 0.31
45 0.24
46 0.23
47 0.21
48 0.2
49 0.2
50 0.17
51 0.12
52 0.1
53 0.09
54 0.08
55 0.08
56 0.08
57 0.11
58 0.12
59 0.14
60 0.17
61 0.16
62 0.16
63 0.16
64 0.18
65 0.16
66 0.16
67 0.16
68 0.13
69 0.13
70 0.13
71 0.13
72 0.11
73 0.1
74 0.12
75 0.11
76 0.14
77 0.14
78 0.14
79 0.13
80 0.16
81 0.16
82 0.14
83 0.14
84 0.13
85 0.15
86 0.15
87 0.17
88 0.17
89 0.18
90 0.23
91 0.23
92 0.3
93 0.34
94 0.39
95 0.44
96 0.5
97 0.55
98 0.59
99 0.67
100 0.66
101 0.69
102 0.71
103 0.67
104 0.61
105 0.58
106 0.48
107 0.4
108 0.32
109 0.24
110 0.21
111 0.19
112 0.19
113 0.18
114 0.19
115 0.2
116 0.2
117 0.21
118 0.18
119 0.18
120 0.2
121 0.27
122 0.34
123 0.39
124 0.4
125 0.4
126 0.46
127 0.51
128 0.55
129 0.58
130 0.56
131 0.6
132 0.7
133 0.69
134 0.65
135 0.59
136 0.52
137 0.43
138 0.35
139 0.25
140 0.15
141 0.12
142 0.1
143 0.1
144 0.08
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.05
151 0.07
152 0.12
153 0.15
154 0.19
155 0.26
156 0.28
157 0.33
158 0.38
159 0.48
160 0.53
161 0.61
162 0.69
163 0.67
164 0.75
165 0.8
166 0.84
167 0.82
168 0.79
169 0.78
170 0.74
171 0.77
172 0.71
173 0.64
174 0.56
175 0.46
176 0.39
177 0.31
178 0.25
179 0.17
180 0.13
181 0.11
182 0.1
183 0.09
184 0.09
185 0.07
186 0.07
187 0.08
188 0.08
189 0.08
190 0.08
191 0.07
192 0.07
193 0.09
194 0.08
195 0.09
196 0.09
197 0.09
198 0.11
199 0.12
200 0.14
201 0.14
202 0.15
203 0.15
204 0.16
205 0.16
206 0.14
207 0.14
208 0.13
209 0.11
210 0.1
211 0.08
212 0.07
213 0.07
214 0.07
215 0.06
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.06
227 0.08
228 0.08
229 0.08
230 0.08
231 0.09
232 0.1
233 0.1
234 0.08
235 0.06
236 0.06
237 0.06
238 0.06
239 0.05
240 0.04
241 0.04
242 0.04
243 0.05
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.05
250 0.08
251 0.11
252 0.12
253 0.14
254 0.16
255 0.17
256 0.21
257 0.21
258 0.21
259 0.18
260 0.18
261 0.15
262 0.15
263 0.14
264 0.13
265 0.12
266 0.1
267 0.1
268 0.14
269 0.16
270 0.21
271 0.22
272 0.22
273 0.24
274 0.25
275 0.26
276 0.24
277 0.28
278 0.25
279 0.23
280 0.24
281 0.24
282 0.24
283 0.23
284 0.21
285 0.16
286 0.15
287 0.13
288 0.12
289 0.1
290 0.09
291 0.08
292 0.08
293 0.08
294 0.08
295 0.08
296 0.06
297 0.05
298 0.05
299 0.05
300 0.05
301 0.04
302 0.05
303 0.05
304 0.05
305 0.05
306 0.07
307 0.07
308 0.07
309 0.08
310 0.07
311 0.08
312 0.09
313 0.1
314 0.1
315 0.11
316 0.12
317 0.13
318 0.13
319 0.13
320 0.12
321 0.1
322 0.1
323 0.09
324 0.09
325 0.08
326 0.1
327 0.09
328 0.13
329 0.19
330 0.24
331 0.32
332 0.39
333 0.49
334 0.5
335 0.56
336 0.55
337 0.58
338 0.62
339 0.61
340 0.6
341 0.52
342 0.52
343 0.5
344 0.53
345 0.54
346 0.48
347 0.45
348 0.4
349 0.42
350 0.39
351 0.37
352 0.31
353 0.25
354 0.27
355 0.27
356 0.27
357 0.25
358 0.25
359 0.25
360 0.25
361 0.23
362 0.19
363 0.22
364 0.26
365 0.31
366 0.32
367 0.32
368 0.34
369 0.35
370 0.37
371 0.33
372 0.31
373 0.33
374 0.33
375 0.33
376 0.3
377 0.29
378 0.27
379 0.31
380 0.34
381 0.3
382 0.36
383 0.42
384 0.48
385 0.52
386 0.53
387 0.47
388 0.41
389 0.4