Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VDT3

Protein Details
Accession A0A1D2VDT3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-93ENENLRVKSTKQKKRKNQPKKTLSKRKHQKITKEGRNBasic
NLS Segment(s)
PositionSequence
64-93KSTKQKKRKNQPKKTLSKRKHQKITKEGRN
Subcellular Location(s) nucl 17.5, cyto_nucl 12.833, mito_nucl 10.166, cyto 6
Family & Domain DBs
Amino Acid Sequences MKKNGKDNDFTKDLWNDCNALHNVIFHQASYTMISDWFLNSKKNEFVDIAKNYFNSENENLRVKSTKQKKRKNQPKKTLSKRKHQKITKEGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.28
4 0.24
5 0.3
6 0.25
7 0.22
8 0.21
9 0.19
10 0.18
11 0.21
12 0.2
13 0.13
14 0.13
15 0.11
16 0.12
17 0.12
18 0.12
19 0.08
20 0.08
21 0.09
22 0.08
23 0.08
24 0.1
25 0.1
26 0.12
27 0.13
28 0.15
29 0.18
30 0.18
31 0.19
32 0.17
33 0.18
34 0.22
35 0.24
36 0.24
37 0.22
38 0.21
39 0.21
40 0.21
41 0.19
42 0.17
43 0.17
44 0.19
45 0.21
46 0.26
47 0.25
48 0.25
49 0.28
50 0.26
51 0.33
52 0.4
53 0.48
54 0.53
55 0.64
56 0.73
57 0.82
58 0.91
59 0.92
60 0.93
61 0.94
62 0.94
63 0.95
64 0.95
65 0.95
66 0.92
67 0.92
68 0.92
69 0.91
70 0.91
71 0.88
72 0.88
73 0.88