Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VNU1

Protein Details
Accession A0A1D2VNU1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-71LLGRAEKPRKRKCEQSWFQNVRNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, E.R. 4, mito 3, cyto 3, extr 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEQLRVWVLLLWLELVWGSSSAGALFCCFYISQFLSLGVLSGFCQYVMLLGRAEKPRKRKCEQSWFQNVRNLLQLLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.05
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.06
17 0.09
18 0.1
19 0.1
20 0.1
21 0.1
22 0.1
23 0.1
24 0.09
25 0.06
26 0.05
27 0.04
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.05
34 0.06
35 0.07
36 0.07
37 0.08
38 0.14
39 0.2
40 0.27
41 0.31
42 0.41
43 0.49
44 0.58
45 0.63
46 0.68
47 0.72
48 0.77
49 0.81
50 0.81
51 0.83
52 0.82
53 0.8
54 0.75
55 0.66
56 0.57
57 0.54
58 0.44