Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2V9L4

Protein Details
Accession A0A1D2V9L4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-61LFSPRSCARKKKHPRRNLFCVASPHydrophilic
NLS Segment(s)
PositionSequence
47-52KKKHPR
Subcellular Location(s) mito 10, extr 7, plas 6, cyto_mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFPLEVIFFCFCLLSFLGVFPCFVFSSVVCVSPARFALFSPRSCARKKKHPRRNLFCVASPAPRPSAVLPLLGARSRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.12
5 0.12
6 0.12
7 0.1
8 0.11
9 0.09
10 0.1
11 0.1
12 0.08
13 0.13
14 0.14
15 0.15
16 0.13
17 0.13
18 0.13
19 0.13
20 0.14
21 0.1
22 0.09
23 0.08
24 0.16
25 0.2
26 0.2
27 0.23
28 0.28
29 0.3
30 0.34
31 0.42
32 0.4
33 0.48
34 0.59
35 0.65
36 0.71
37 0.78
38 0.85
39 0.86
40 0.89
41 0.88
42 0.81
43 0.72
44 0.69
45 0.61
46 0.55
47 0.49
48 0.42
49 0.35
50 0.31
51 0.3
52 0.24
53 0.27
54 0.23
55 0.21
56 0.19
57 0.21
58 0.24