Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VKZ6

Protein Details
Accession A0A1D2VKZ6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-46DLQNKPFSSRRLTRRNKKQRMGLLLAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR042777  Sen15_fungi  
IPR018593  tRNA-endonuc_su_Sen15  
IPR011856  tRNA_endonuc-like_dom_sf  
IPR036167  tRNA_intron_Endo_cat-like_sf  
Gene Ontology GO:0000214  C:tRNA-intron endonuclease complex  
GO:0003676  F:nucleic acid binding  
GO:0000379  P:tRNA-type intron splice site recognition and cleavage  
Pfam View protein in Pfam  
PF09631  Sen15  
Amino Acid Sequences MSPLSQYVCNTCLFHYLIILDLQNKPFSSRRLTRRNKKQRMGLLLADPFFANYSLKQKLFDLRSELVQDNEVMSVLSNQVKQNLVYYNLWSNAKEVPIVVSDSKCFVLKALPPSDFSSSSSDSLNFKFSKLQEAEKDSSVGSDGREEYEYILPVDMDDKITMKFLDDCFEQIKISERIASRPNRIILGMVNDDSTIVYYFVHDGIAKPRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.15
5 0.16
6 0.16
7 0.14
8 0.17
9 0.19
10 0.21
11 0.21
12 0.24
13 0.26
14 0.29
15 0.35
16 0.4
17 0.48
18 0.56
19 0.67
20 0.74
21 0.81
22 0.89
23 0.91
24 0.9
25 0.89
26 0.86
27 0.84
28 0.78
29 0.7
30 0.64
31 0.57
32 0.49
33 0.41
34 0.32
35 0.24
36 0.19
37 0.16
38 0.11
39 0.09
40 0.15
41 0.19
42 0.2
43 0.21
44 0.22
45 0.29
46 0.3
47 0.31
48 0.31
49 0.27
50 0.29
51 0.31
52 0.31
53 0.24
54 0.22
55 0.19
56 0.14
57 0.12
58 0.1
59 0.06
60 0.06
61 0.05
62 0.06
63 0.08
64 0.1
65 0.1
66 0.12
67 0.13
68 0.13
69 0.15
70 0.15
71 0.17
72 0.15
73 0.17
74 0.17
75 0.19
76 0.2
77 0.17
78 0.17
79 0.15
80 0.15
81 0.13
82 0.1
83 0.08
84 0.08
85 0.1
86 0.1
87 0.09
88 0.09
89 0.1
90 0.11
91 0.1
92 0.09
93 0.08
94 0.09
95 0.12
96 0.17
97 0.18
98 0.19
99 0.2
100 0.23
101 0.25
102 0.24
103 0.22
104 0.21
105 0.2
106 0.2
107 0.19
108 0.18
109 0.17
110 0.17
111 0.19
112 0.16
113 0.14
114 0.18
115 0.18
116 0.24
117 0.24
118 0.27
119 0.27
120 0.33
121 0.35
122 0.31
123 0.32
124 0.24
125 0.22
126 0.19
127 0.16
128 0.1
129 0.1
130 0.1
131 0.11
132 0.11
133 0.11
134 0.13
135 0.14
136 0.14
137 0.12
138 0.12
139 0.1
140 0.09
141 0.1
142 0.08
143 0.07
144 0.07
145 0.08
146 0.08
147 0.1
148 0.09
149 0.1
150 0.13
151 0.12
152 0.15
153 0.15
154 0.17
155 0.17
156 0.18
157 0.17
158 0.14
159 0.2
160 0.18
161 0.19
162 0.22
163 0.21
164 0.25
165 0.33
166 0.38
167 0.39
168 0.43
169 0.44
170 0.4
171 0.4
172 0.36
173 0.31
174 0.3
175 0.27
176 0.22
177 0.2
178 0.18
179 0.18
180 0.17
181 0.16
182 0.11
183 0.08
184 0.07
185 0.08
186 0.09
187 0.09
188 0.11
189 0.1
190 0.11
191 0.21