Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A0HRV9

Protein Details
Accession A0A0A0HRV9   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-72EKTIRDKTRKPKPYTYRACFRKRETREKREKKKEAIYNHKGCBasic
NLS Segment(s)
PositionSequence
35-43RDKTRKPKP
50-63FRKRETREKREKKK
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 7, cyto 5
Family & Domain DBs
KEGG pbn:PADG_11924  -  
Amino Acid Sequences MKNPHLVAIANMILQEVSMLEGKREREMGQEKTIRDKTRKPKPYTYRACFRKRETREKREKKKEAIYNHKGCVAGNKELEITKGGIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.04
4 0.05
5 0.08
6 0.08
7 0.09
8 0.12
9 0.14
10 0.16
11 0.17
12 0.16
13 0.21
14 0.27
15 0.3
16 0.35
17 0.38
18 0.37
19 0.44
20 0.5
21 0.47
22 0.45
23 0.5
24 0.52
25 0.58
26 0.67
27 0.65
28 0.69
29 0.73
30 0.79
31 0.8
32 0.77
33 0.76
34 0.75
35 0.76
36 0.73
37 0.71
38 0.71
39 0.68
40 0.74
41 0.74
42 0.77
43 0.8
44 0.85
45 0.9
46 0.9
47 0.91
48 0.88
49 0.87
50 0.84
51 0.83
52 0.83
53 0.82
54 0.77
55 0.71
56 0.66
57 0.56
58 0.49
59 0.47
60 0.41
61 0.37
62 0.31
63 0.31
64 0.29
65 0.3
66 0.31
67 0.24