Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VKE7

Protein Details
Accession A0A1D2VKE7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-120DEWSKELQVKSRRIRKQNSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019269  BLOC1_su2  
Pfam View protein in Pfam  
PF10046  BLOC1_2  
Amino Acid Sequences MPSKKLPTKDSSQELIKDSITNITRIIENDTDISLIDLNLIQQLNTQKTLNLMKLERKLDLILNESKQITQINEDLTNTLTKLNVLENQVNHLERIAKEMDEWSKELQVKSRRIRKQNSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.4
4 0.32
5 0.26
6 0.28
7 0.24
8 0.21
9 0.19
10 0.18
11 0.18
12 0.18
13 0.22
14 0.16
15 0.16
16 0.16
17 0.15
18 0.14
19 0.13
20 0.12
21 0.08
22 0.07
23 0.06
24 0.05
25 0.05
26 0.07
27 0.07
28 0.06
29 0.09
30 0.13
31 0.14
32 0.16
33 0.16
34 0.14
35 0.17
36 0.2
37 0.19
38 0.19
39 0.19
40 0.22
41 0.27
42 0.28
43 0.25
44 0.24
45 0.23
46 0.21
47 0.2
48 0.18
49 0.16
50 0.16
51 0.17
52 0.16
53 0.15
54 0.15
55 0.15
56 0.12
57 0.11
58 0.12
59 0.13
60 0.13
61 0.14
62 0.13
63 0.13
64 0.13
65 0.11
66 0.1
67 0.07
68 0.07
69 0.08
70 0.09
71 0.11
72 0.15
73 0.18
74 0.18
75 0.21
76 0.25
77 0.24
78 0.22
79 0.2
80 0.2
81 0.17
82 0.21
83 0.18
84 0.15
85 0.15
86 0.2
87 0.23
88 0.22
89 0.24
90 0.22
91 0.27
92 0.3
93 0.31
94 0.35
95 0.39
96 0.46
97 0.55
98 0.63
99 0.67
100 0.73