Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VNM1

Protein Details
Accession A0A1D2VNM1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-104LIKVNENKNEKKTRKKRRGVSKRKKSKENLNKSNBasic
NLS Segment(s)
PositionSequence
78-99KNEKKTRKKRRGVSKRKKSKEN
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MVKENGSNNRNNSANIHNGCTIFDFKDYLTGLIEDENGNGNGNGKTKEKIELIENEKMEEVKWMENKLLDLIKVNENKNEKKTRKKRRGVSKRKKSKENLNKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.38
4 0.34
5 0.32
6 0.32
7 0.3
8 0.27
9 0.19
10 0.18
11 0.15
12 0.13
13 0.17
14 0.17
15 0.15
16 0.13
17 0.12
18 0.12
19 0.11
20 0.12
21 0.07
22 0.07
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.11
30 0.13
31 0.13
32 0.14
33 0.14
34 0.17
35 0.16
36 0.16
37 0.17
38 0.22
39 0.25
40 0.28
41 0.27
42 0.25
43 0.24
44 0.23
45 0.2
46 0.16
47 0.13
48 0.12
49 0.14
50 0.14
51 0.15
52 0.15
53 0.16
54 0.16
55 0.15
56 0.12
57 0.13
58 0.14
59 0.2
60 0.25
61 0.25
62 0.29
63 0.34
64 0.39
65 0.46
66 0.54
67 0.55
68 0.61
69 0.71
70 0.77
71 0.82
72 0.87
73 0.88
74 0.89
75 0.93
76 0.93
77 0.94
78 0.94
79 0.94
80 0.94
81 0.94
82 0.91
83 0.91
84 0.9