Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VD61

Protein Details
Accession A0A1D2VD61    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
435-460DKIKATGRGNKKSKDIKEKEAEKQEEBasic
NLS Segment(s)
PositionSequence
436-482KIKATGRGNKKSKDIKEKEAEKQEEKKVKDAKIEGKDDLERELKKPK
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017423  TRM6  
Gene Ontology GO:0005634  C:nucleus  
GO:0031515  C:tRNA (m1A) methyltransferase complex  
GO:0008168  F:methyltransferase activity  
GO:0030488  P:tRNA methylation  
Pfam View protein in Pfam  
PF04189  Gcd10p  
Amino Acid Sequences MNEEFVLETKGKNRLIISPNQYCFIKLPSSGIKIVQLRPDGVISLGKFGCFEVNSVLNHPYGETFEIIENKQARAIYTDAFEAGNDDEDLEEENISEAEISSKLLSTDKENKSRLDNRDVNDIGSGVQKLTSVEIELLKKDSELSNKGKGIIEKLIESHTNFNKKTVHSQEKYVKRKQQKFLKVFTIEYLSASNLLRFYTSKDFGKIHELSEESLGLMISLADVRPGGRYLVVDECLGLIVYTMMERMNLQGEIVLIHENEHANLISLKYSDYSEEEIKKFVKTINWLQFFEPDNEKIKFPIKSETEISLLTAQKRSNYYRHKRNAEITNSVIDNVKRGQFDGLIMASTLYLPKLLPKIVDKIGGSRAIVCYSNNKELLNETNHVLLNDVRVINSKILETRVRPYQSIPGKLHPLMTIRSGGGYLLWGLRVIPGDKIKATGRGNKKSKDIKEKEAEKQEEKKVKDAKIEGKDDLERELKKPKIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.48
4 0.52
5 0.54
6 0.55
7 0.56
8 0.54
9 0.47
10 0.43
11 0.38
12 0.33
13 0.24
14 0.28
15 0.3
16 0.35
17 0.35
18 0.34
19 0.37
20 0.39
21 0.42
22 0.43
23 0.39
24 0.35
25 0.35
26 0.34
27 0.28
28 0.23
29 0.24
30 0.18
31 0.21
32 0.2
33 0.19
34 0.18
35 0.18
36 0.2
37 0.16
38 0.17
39 0.15
40 0.18
41 0.19
42 0.22
43 0.23
44 0.2
45 0.19
46 0.19
47 0.16
48 0.14
49 0.15
50 0.13
51 0.12
52 0.15
53 0.19
54 0.19
55 0.24
56 0.24
57 0.23
58 0.25
59 0.24
60 0.22
61 0.21
62 0.23
63 0.18
64 0.17
65 0.17
66 0.15
67 0.15
68 0.14
69 0.12
70 0.11
71 0.11
72 0.09
73 0.09
74 0.08
75 0.08
76 0.1
77 0.09
78 0.08
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.05
85 0.06
86 0.06
87 0.07
88 0.07
89 0.07
90 0.08
91 0.1
92 0.11
93 0.17
94 0.27
95 0.33
96 0.41
97 0.43
98 0.45
99 0.52
100 0.59
101 0.58
102 0.58
103 0.56
104 0.5
105 0.57
106 0.55
107 0.47
108 0.39
109 0.33
110 0.24
111 0.21
112 0.19
113 0.09
114 0.09
115 0.09
116 0.09
117 0.1
118 0.09
119 0.08
120 0.09
121 0.12
122 0.13
123 0.14
124 0.15
125 0.14
126 0.14
127 0.15
128 0.16
129 0.18
130 0.22
131 0.26
132 0.31
133 0.32
134 0.34
135 0.35
136 0.33
137 0.31
138 0.29
139 0.25
140 0.2
141 0.2
142 0.2
143 0.2
144 0.2
145 0.24
146 0.26
147 0.32
148 0.32
149 0.34
150 0.36
151 0.36
152 0.43
153 0.46
154 0.5
155 0.45
156 0.52
157 0.58
158 0.64
159 0.7
160 0.7
161 0.69
162 0.69
163 0.77
164 0.78
165 0.79
166 0.8
167 0.78
168 0.75
169 0.74
170 0.66
171 0.58
172 0.5
173 0.43
174 0.33
175 0.27
176 0.22
177 0.14
178 0.13
179 0.13
180 0.12
181 0.08
182 0.08
183 0.09
184 0.08
185 0.12
186 0.16
187 0.19
188 0.19
189 0.22
190 0.23
191 0.23
192 0.3
193 0.27
194 0.22
195 0.21
196 0.2
197 0.18
198 0.18
199 0.17
200 0.09
201 0.09
202 0.08
203 0.05
204 0.05
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.04
213 0.05
214 0.05
215 0.05
216 0.05
217 0.07
218 0.09
219 0.1
220 0.09
221 0.08
222 0.08
223 0.08
224 0.07
225 0.05
226 0.04
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.04
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.06
242 0.06
243 0.05
244 0.05
245 0.07
246 0.07
247 0.07
248 0.07
249 0.06
250 0.06
251 0.07
252 0.07
253 0.06
254 0.06
255 0.06
256 0.06
257 0.07
258 0.07
259 0.08
260 0.11
261 0.14
262 0.18
263 0.19
264 0.2
265 0.21
266 0.2
267 0.19
268 0.18
269 0.17
270 0.19
271 0.27
272 0.34
273 0.37
274 0.38
275 0.38
276 0.41
277 0.39
278 0.37
279 0.32
280 0.25
281 0.26
282 0.26
283 0.26
284 0.23
285 0.26
286 0.25
287 0.24
288 0.29
289 0.27
290 0.29
291 0.31
292 0.31
293 0.28
294 0.25
295 0.25
296 0.21
297 0.21
298 0.19
299 0.2
300 0.19
301 0.21
302 0.25
303 0.28
304 0.33
305 0.42
306 0.49
307 0.57
308 0.66
309 0.69
310 0.69
311 0.74
312 0.73
313 0.68
314 0.62
315 0.54
316 0.47
317 0.41
318 0.37
319 0.31
320 0.22
321 0.19
322 0.18
323 0.19
324 0.16
325 0.17
326 0.17
327 0.15
328 0.16
329 0.15
330 0.13
331 0.1
332 0.09
333 0.09
334 0.07
335 0.07
336 0.07
337 0.05
338 0.05
339 0.05
340 0.08
341 0.11
342 0.11
343 0.14
344 0.16
345 0.21
346 0.23
347 0.27
348 0.24
349 0.25
350 0.28
351 0.28
352 0.25
353 0.22
354 0.21
355 0.19
356 0.2
357 0.17
358 0.21
359 0.24
360 0.3
361 0.3
362 0.29
363 0.27
364 0.29
365 0.34
366 0.31
367 0.27
368 0.23
369 0.24
370 0.25
371 0.24
372 0.23
373 0.17
374 0.15
375 0.17
376 0.16
377 0.13
378 0.16
379 0.18
380 0.18
381 0.18
382 0.18
383 0.16
384 0.2
385 0.24
386 0.24
387 0.27
388 0.34
389 0.36
390 0.36
391 0.36
392 0.41
393 0.45
394 0.5
395 0.49
396 0.46
397 0.5
398 0.5
399 0.49
400 0.43
401 0.38
402 0.32
403 0.31
404 0.27
405 0.21
406 0.2
407 0.19
408 0.16
409 0.12
410 0.11
411 0.1
412 0.08
413 0.08
414 0.08
415 0.08
416 0.09
417 0.12
418 0.12
419 0.16
420 0.19
421 0.22
422 0.22
423 0.26
424 0.26
425 0.32
426 0.37
427 0.41
428 0.48
429 0.55
430 0.63
431 0.65
432 0.72
433 0.74
434 0.78
435 0.8
436 0.77
437 0.77
438 0.79
439 0.81
440 0.81
441 0.82
442 0.8
443 0.76
444 0.78
445 0.78
446 0.76
447 0.71
448 0.7
449 0.67
450 0.65
451 0.66
452 0.65
453 0.65
454 0.65
455 0.68
456 0.61
457 0.58
458 0.58
459 0.5
460 0.48
461 0.45
462 0.39
463 0.38
464 0.45