Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VFU0

Protein Details
Accession A0A1D2VFU0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-112NRSHQSRHKSSKPPNQNERNKKNKSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
IPR009060  UBA-like_sf  
Gene Ontology GO:0043130  F:ubiquitin binding  
Pfam View protein in Pfam  
PF02845  CUE  
PROSITE View protein in PROSITE  
PS51140  CUE  
Amino Acid Sequences LQDAFPTIDQKYINAVLIASSGNLDSAFSALLYLSDPNFKIDLPTPKNQSLNLPSNDQFKKMNQLEQDELLAKRLAKQFEMESTQSNRSHQSRHKSSKPPNQNERNKKNKSEYYDGDSDSDDPFTTFIDEDLPQIKKEIAKGFEETKLKVNNWVSELTKKFNQNENDNNTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.13
4 0.14
5 0.13
6 0.08
7 0.07
8 0.06
9 0.06
10 0.06
11 0.06
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.04
18 0.05
19 0.05
20 0.06
21 0.07
22 0.1
23 0.1
24 0.12
25 0.13
26 0.12
27 0.14
28 0.19
29 0.28
30 0.31
31 0.37
32 0.4
33 0.44
34 0.46
35 0.44
36 0.45
37 0.42
38 0.44
39 0.4
40 0.39
41 0.36
42 0.43
43 0.43
44 0.39
45 0.33
46 0.27
47 0.34
48 0.31
49 0.34
50 0.29
51 0.32
52 0.32
53 0.31
54 0.31
55 0.23
56 0.21
57 0.18
58 0.17
59 0.13
60 0.16
61 0.19
62 0.18
63 0.16
64 0.18
65 0.17
66 0.19
67 0.23
68 0.19
69 0.18
70 0.2
71 0.24
72 0.23
73 0.23
74 0.25
75 0.23
76 0.28
77 0.31
78 0.38
79 0.43
80 0.5
81 0.58
82 0.63
83 0.71
84 0.75
85 0.8
86 0.8
87 0.8
88 0.83
89 0.85
90 0.87
91 0.87
92 0.88
93 0.82
94 0.79
95 0.77
96 0.73
97 0.69
98 0.66
99 0.6
100 0.55
101 0.53
102 0.48
103 0.41
104 0.35
105 0.29
106 0.22
107 0.19
108 0.13
109 0.09
110 0.09
111 0.08
112 0.08
113 0.07
114 0.07
115 0.09
116 0.09
117 0.1
118 0.15
119 0.16
120 0.15
121 0.16
122 0.18
123 0.17
124 0.21
125 0.26
126 0.25
127 0.26
128 0.3
129 0.32
130 0.37
131 0.39
132 0.35
133 0.36
134 0.38
135 0.36
136 0.4
137 0.41
138 0.38
139 0.38
140 0.4
141 0.37
142 0.4
143 0.43
144 0.41
145 0.43
146 0.46
147 0.49
148 0.53
149 0.57
150 0.58
151 0.64