Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VSF3

Protein Details
Accession A0A1D2VSF3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
53-75MVKTSQFERKNKNKNKKELSVFDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 6, cyto_nucl 5.5, plas 5, pero 4, mito 3, cyto 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences MVYSKILFSDVLDYIQIQEIVFPLWCRQPWNSLSAILYNQQKLLLSFTKSKIMVKTSQFERKNKNKNKKELSVFDSILKSRLIFCLFLMGVCFMFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.13
4 0.09
5 0.09
6 0.08
7 0.09
8 0.09
9 0.09
10 0.09
11 0.13
12 0.14
13 0.17
14 0.18
15 0.23
16 0.24
17 0.26
18 0.25
19 0.23
20 0.22
21 0.21
22 0.2
23 0.19
24 0.2
25 0.17
26 0.16
27 0.15
28 0.15
29 0.13
30 0.16
31 0.14
32 0.14
33 0.17
34 0.18
35 0.22
36 0.22
37 0.23
38 0.22
39 0.23
40 0.25
41 0.25
42 0.3
43 0.31
44 0.4
45 0.45
46 0.48
47 0.55
48 0.6
49 0.68
50 0.72
51 0.78
52 0.78
53 0.82
54 0.85
55 0.85
56 0.82
57 0.78
58 0.73
59 0.69
60 0.61
61 0.54
62 0.48
63 0.4
64 0.34
65 0.27
66 0.23
67 0.17
68 0.2
69 0.18
70 0.16
71 0.15
72 0.2
73 0.19
74 0.19
75 0.19
76 0.16