Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VM70

Protein Details
Accession A0A1D2VM70   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHQKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
9-23KIVKKHQKKFKRHHS
Subcellular Location(s) mito 14.5, mito_nucl 12, nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHQKKFKRHHSDRYHRVSENWRKQKGIDSCVRRRFRGTISQPKIGYGSNKKTRGMMPSGHKAFLVANVKDLDLLLLHTKSYAAEIAHNVSSRNRVDILKRAKALGLKVTNPKGRLSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.81
3 0.89
4 0.92
5 0.93
6 0.93
7 0.91
8 0.91
9 0.92
10 0.93
11 0.92
12 0.9
13 0.85
14 0.75
15 0.71
16 0.71
17 0.7
18 0.7
19 0.7
20 0.64
21 0.58
22 0.58
23 0.62
24 0.58
25 0.54
26 0.52
27 0.51
28 0.57
29 0.66
30 0.68
31 0.61
32 0.58
33 0.54
34 0.49
35 0.51
36 0.5
37 0.52
38 0.53
39 0.58
40 0.54
41 0.51
42 0.48
43 0.38
44 0.35
45 0.31
46 0.35
47 0.38
48 0.4
49 0.4
50 0.41
51 0.42
52 0.39
53 0.35
54 0.31
55 0.28
56 0.34
57 0.35
58 0.34
59 0.32
60 0.28
61 0.25
62 0.26
63 0.26
64 0.18
65 0.18
66 0.19
67 0.19
68 0.18
69 0.18
70 0.12
71 0.06
72 0.07
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07
79 0.08
80 0.09
81 0.07
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.16
88 0.16
89 0.21
90 0.2
91 0.21
92 0.2
93 0.21
94 0.25
95 0.34
96 0.41
97 0.42
98 0.43
99 0.42
100 0.42
101 0.42
102 0.41
103 0.41
104 0.38
105 0.37
106 0.44
107 0.51
108 0.54
109 0.52
110 0.51
111 0.46