Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2V9S5

Protein Details
Accession A0A1D2V9S5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
184-204KGTKYLKKLRILKADNNRIEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF00560  LRR_1  
PF13516  LRR_6  
PROSITE View protein in PROSITE  
PS51450  LRR  
Amino Acid Sequences NVTEISQIDISFSINKKNLVSSITDRIYDKKSWDLISDIDLSGKELVSLNDLMNLLPNLRTLNISNNMIRFLDGCPKKIDSIIGVNNKFDGTCSFSKYRDLEYLNLMRNSLENLMSFKQLIHLKELNVRYNKINDLSGIGYIQNLIKVDLRNNRIKEGINFKKWRRLIHLEQIDLSNNRILEIKGTKYLKKLRILKADNNRIEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.29
5 0.29
6 0.26
7 0.3
8 0.28
9 0.33
10 0.33
11 0.34
12 0.33
13 0.36
14 0.38
15 0.35
16 0.33
17 0.31
18 0.33
19 0.32
20 0.32
21 0.3
22 0.26
23 0.27
24 0.26
25 0.2
26 0.17
27 0.15
28 0.15
29 0.13
30 0.12
31 0.1
32 0.09
33 0.09
34 0.1
35 0.12
36 0.1
37 0.12
38 0.12
39 0.11
40 0.12
41 0.12
42 0.1
43 0.09
44 0.1
45 0.08
46 0.09
47 0.11
48 0.1
49 0.16
50 0.19
51 0.21
52 0.22
53 0.22
54 0.23
55 0.21
56 0.2
57 0.15
58 0.13
59 0.2
60 0.19
61 0.21
62 0.22
63 0.23
64 0.23
65 0.23
66 0.22
67 0.15
68 0.18
69 0.23
70 0.27
71 0.27
72 0.26
73 0.26
74 0.25
75 0.23
76 0.18
77 0.13
78 0.12
79 0.12
80 0.17
81 0.18
82 0.19
83 0.23
84 0.24
85 0.25
86 0.23
87 0.24
88 0.2
89 0.23
90 0.26
91 0.25
92 0.24
93 0.22
94 0.18
95 0.17
96 0.17
97 0.13
98 0.1
99 0.07
100 0.09
101 0.1
102 0.11
103 0.11
104 0.09
105 0.13
106 0.16
107 0.17
108 0.19
109 0.2
110 0.21
111 0.27
112 0.3
113 0.32
114 0.31
115 0.33
116 0.3
117 0.3
118 0.32
119 0.27
120 0.24
121 0.18
122 0.17
123 0.16
124 0.14
125 0.12
126 0.1
127 0.08
128 0.08
129 0.08
130 0.07
131 0.07
132 0.08
133 0.1
134 0.11
135 0.17
136 0.24
137 0.3
138 0.36
139 0.38
140 0.39
141 0.39
142 0.4
143 0.4
144 0.43
145 0.47
146 0.49
147 0.55
148 0.56
149 0.63
150 0.64
151 0.63
152 0.61
153 0.61
154 0.59
155 0.62
156 0.65
157 0.57
158 0.56
159 0.53
160 0.49
161 0.41
162 0.35
163 0.27
164 0.19
165 0.18
166 0.18
167 0.16
168 0.18
169 0.21
170 0.23
171 0.28
172 0.33
173 0.35
174 0.42
175 0.51
176 0.52
177 0.58
178 0.64
179 0.65
180 0.72
181 0.76
182 0.77
183 0.79
184 0.83
185 0.81