Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VI59

Protein Details
Accession A0A1D2VI59   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
157-179YKPPPTTAPAQKKKRGFFGKKKKBasic
NLS Segment(s)
PositionSequence
166-179AQKKKRGFFGKKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MAVFGGKSPKKNNRASTNSIKLTKADKDLFKNRNSRAQDMMNAINEDQPFQQASDQFDQGKDNGDSMGNFSKSNGINDVFGNPITVVDMSNPTRSRDERPLDTIRSFEFSISGDSVYREQLETARYGFRPRPEFPLLKGNPYANTANTSDSIYVPAYKPPPTTAPAQKKKRGFFGKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.79
4 0.78
5 0.76
6 0.71
7 0.63
8 0.55
9 0.53
10 0.49
11 0.46
12 0.43
13 0.42
14 0.47
15 0.56
16 0.59
17 0.61
18 0.65
19 0.62
20 0.65
21 0.63
22 0.58
23 0.54
24 0.51
25 0.47
26 0.43
27 0.42
28 0.35
29 0.31
30 0.28
31 0.26
32 0.23
33 0.2
34 0.16
35 0.14
36 0.12
37 0.12
38 0.14
39 0.13
40 0.18
41 0.2
42 0.21
43 0.21
44 0.21
45 0.21
46 0.19
47 0.21
48 0.16
49 0.14
50 0.12
51 0.12
52 0.11
53 0.13
54 0.17
55 0.14
56 0.13
57 0.13
58 0.18
59 0.18
60 0.19
61 0.18
62 0.14
63 0.15
64 0.15
65 0.16
66 0.11
67 0.1
68 0.1
69 0.07
70 0.07
71 0.06
72 0.06
73 0.05
74 0.05
75 0.08
76 0.09
77 0.13
78 0.14
79 0.15
80 0.18
81 0.2
82 0.24
83 0.29
84 0.33
85 0.31
86 0.37
87 0.39
88 0.4
89 0.38
90 0.35
91 0.27
92 0.26
93 0.23
94 0.17
95 0.13
96 0.11
97 0.12
98 0.11
99 0.11
100 0.08
101 0.09
102 0.1
103 0.1
104 0.1
105 0.08
106 0.08
107 0.1
108 0.11
109 0.11
110 0.12
111 0.14
112 0.14
113 0.19
114 0.22
115 0.27
116 0.32
117 0.33
118 0.38
119 0.42
120 0.43
121 0.42
122 0.49
123 0.43
124 0.42
125 0.43
126 0.38
127 0.33
128 0.35
129 0.33
130 0.24
131 0.26
132 0.23
133 0.21
134 0.21
135 0.2
136 0.17
137 0.16
138 0.17
139 0.14
140 0.16
141 0.15
142 0.2
143 0.21
144 0.23
145 0.25
146 0.26
147 0.29
148 0.29
149 0.36
150 0.41
151 0.5
152 0.57
153 0.65
154 0.71
155 0.75
156 0.78
157 0.81
158 0.81
159 0.81