Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D2VGC7

Protein Details
Accession A0A1D2VGC7    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-50EISRSLCRCNEKKNKKKMPNNQRVCLLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, nucl 5.5, cyto_nucl 4.5, plas 4, mito 3, cyto 2.5, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFGIYVWFLFSLTPLASINSSIMEISRSLCRCNEKKNKKKMPNNQRVCLLTLVQSLELLQLVVCVCAMILDISASNCLCNRYVAINNALQRSKYFCKTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.11
5 0.11
6 0.09
7 0.09
8 0.08
9 0.08
10 0.07
11 0.07
12 0.09
13 0.15
14 0.15
15 0.16
16 0.2
17 0.28
18 0.31
19 0.41
20 0.5
21 0.55
22 0.64
23 0.74
24 0.82
25 0.84
26 0.9
27 0.9
28 0.91
29 0.9
30 0.88
31 0.81
32 0.74
33 0.65
34 0.57
35 0.47
36 0.36
37 0.26
38 0.19
39 0.16
40 0.11
41 0.1
42 0.08
43 0.07
44 0.06
45 0.05
46 0.03
47 0.04
48 0.04
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.04
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.06
61 0.06
62 0.07
63 0.08
64 0.09
65 0.1
66 0.1
67 0.12
68 0.15
69 0.19
70 0.22
71 0.26
72 0.29
73 0.32
74 0.37
75 0.37
76 0.33
77 0.31
78 0.35
79 0.38