Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VK04

Protein Details
Accession A0A1D2VK04   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPFKKIKRSSFRKALRARAAFHydrophilic
NLS Segment(s)
PositionSequence
8-9KR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MAPFKKIKRSSFRKALRARAAFISEAHDDKIRFKNDSADLVIYLNYVLFINSIVNEIKLLKEKDNSNDLNLVHLNNIKEKMLKKFKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.82
4 0.76
5 0.68
6 0.61
7 0.55
8 0.46
9 0.38
10 0.32
11 0.24
12 0.22
13 0.21
14 0.2
15 0.18
16 0.21
17 0.28
18 0.26
19 0.25
20 0.25
21 0.3
22 0.29
23 0.31
24 0.28
25 0.22
26 0.19
27 0.18
28 0.17
29 0.11
30 0.09
31 0.06
32 0.05
33 0.04
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.08
45 0.13
46 0.15
47 0.16
48 0.21
49 0.25
50 0.29
51 0.36
52 0.36
53 0.33
54 0.35
55 0.32
56 0.31
57 0.29
58 0.25
59 0.2
60 0.22
61 0.21
62 0.22
63 0.24
64 0.22
65 0.26
66 0.29
67 0.37