Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VEA6

Protein Details
Accession A0A1D2VEA6    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPKKRASNGRNKKGRGHVKPVRCTNCSHydrophilic
83-114IVRVRSREGRKVRTPPQRPRFNKDNRIKPTDAHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
85-117RVRSREGRKVRTPPQRPRFNKDNRIKPTDAAKK
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCTNCSRCVPKDKAIKRVTQRGIVESVATRDLSEASVYDEYVLPKIYNKLHYCVSCAIHSKIVRVRSREGRKVRTPPQRPRFNKDNRIKPTDAAKKAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.77
6 0.82
7 0.84
8 0.8
9 0.73
10 0.72
11 0.68
12 0.69
13 0.67
14 0.64
15 0.61
16 0.63
17 0.65
18 0.66
19 0.7
20 0.65
21 0.67
22 0.65
23 0.66
24 0.63
25 0.68
26 0.63
27 0.59
28 0.55
29 0.47
30 0.45
31 0.37
32 0.31
33 0.22
34 0.19
35 0.14
36 0.12
37 0.1
38 0.08
39 0.08
40 0.07
41 0.07
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.06
52 0.07
53 0.11
54 0.12
55 0.19
56 0.2
57 0.22
58 0.26
59 0.27
60 0.28
61 0.29
62 0.28
63 0.24
64 0.27
65 0.25
66 0.27
67 0.27
68 0.29
69 0.3
70 0.36
71 0.38
72 0.38
73 0.43
74 0.48
75 0.56
76 0.62
77 0.66
78 0.66
79 0.7
80 0.75
81 0.78
82 0.79
83 0.8
84 0.82
85 0.84
86 0.86
87 0.84
88 0.84
89 0.84
90 0.84
91 0.85
92 0.84
93 0.84
94 0.81
95 0.83
96 0.76
97 0.7
98 0.7
99 0.7