Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VGE0

Protein Details
Accession A0A1D2VGE0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-99PSPFIRQSHVKKKDKTPKHNKKKFYSFLSLHydrophilic
NLS Segment(s)
PositionSequence
80-92KKKDKTPKHNKKK
Subcellular Location(s) extr 13, plas 7, mito 3, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRGLAARGVLPLVNEVLVLPLSLVILLLVPLLLLVPILAPVLLPTAILSLLVPAANGPLSAASETKFQIPSPFIRQSHVKKKDKTPKHNKKKFYSFLSLEITFINYRLSLIHHFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.07
5 0.06
6 0.05
7 0.05
8 0.04
9 0.04
10 0.04
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.03
25 0.03
26 0.02
27 0.03
28 0.04
29 0.04
30 0.04
31 0.03
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.05
50 0.07
51 0.07
52 0.09
53 0.1
54 0.1
55 0.12
56 0.14
57 0.16
58 0.21
59 0.28
60 0.26
61 0.29
62 0.36
63 0.42
64 0.52
65 0.59
66 0.61
67 0.6
68 0.71
69 0.78
70 0.81
71 0.84
72 0.85
73 0.86
74 0.89
75 0.91
76 0.9
77 0.89
78 0.89
79 0.86
80 0.82
81 0.79
82 0.71
83 0.67
84 0.64
85 0.55
86 0.45
87 0.37
88 0.33
89 0.24
90 0.21
91 0.17
92 0.11
93 0.11
94 0.11
95 0.14