Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VE32

Protein Details
Accession A0A1D2VE32    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
127-152MVSLKNKMRKEKMRKVRNTPTRQEVLHydrophilic
NLS Segment(s)
PositionSequence
133-141KMRKEKMRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.833, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR022592  Nucleolar_19  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0042274  P:ribosomal small subunit biogenesis  
Pfam View protein in Pfam  
PF10863  NOP19  
Amino Acid Sequences KKKQQQGLNKQLSLQFRYSLNNINRRIKNWIESDGRNEANSNISDTVSASNDEFLKLPIITNGFGLSFASSGNKEEDKTRQQKEHIKTVEQFLKTDQKLNKITMSQNRSQNNKQPSFRINKEDSKAMVSLKNKMRKEKMRKVRNTPTRQEVLDDNDGSDSELRWKKTIQIKRGSGLLLDASKKSKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.4
3 0.32
4 0.35
5 0.35
6 0.39
7 0.41
8 0.45
9 0.5
10 0.57
11 0.59
12 0.57
13 0.62
14 0.56
15 0.55
16 0.5
17 0.5
18 0.46
19 0.45
20 0.47
21 0.47
22 0.43
23 0.37
24 0.34
25 0.28
26 0.25
27 0.23
28 0.21
29 0.15
30 0.14
31 0.14
32 0.14
33 0.15
34 0.12
35 0.13
36 0.1
37 0.11
38 0.11
39 0.12
40 0.11
41 0.1
42 0.11
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.1
49 0.1
50 0.08
51 0.08
52 0.08
53 0.07
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.1
60 0.1
61 0.11
62 0.13
63 0.19
64 0.27
65 0.34
66 0.37
67 0.39
68 0.44
69 0.52
70 0.54
71 0.57
72 0.51
73 0.46
74 0.43
75 0.45
76 0.45
77 0.37
78 0.33
79 0.26
80 0.31
81 0.28
82 0.33
83 0.29
84 0.3
85 0.32
86 0.33
87 0.32
88 0.27
89 0.32
90 0.33
91 0.37
92 0.37
93 0.41
94 0.45
95 0.49
96 0.51
97 0.53
98 0.55
99 0.56
100 0.52
101 0.5
102 0.51
103 0.53
104 0.53
105 0.53
106 0.49
107 0.49
108 0.49
109 0.48
110 0.43
111 0.37
112 0.34
113 0.29
114 0.28
115 0.24
116 0.29
117 0.34
118 0.42
119 0.43
120 0.5
121 0.57
122 0.63
123 0.72
124 0.74
125 0.77
126 0.79
127 0.85
128 0.87
129 0.88
130 0.89
131 0.87
132 0.83
133 0.8
134 0.74
135 0.65
136 0.58
137 0.51
138 0.46
139 0.43
140 0.36
141 0.29
142 0.25
143 0.25
144 0.23
145 0.2
146 0.14
147 0.17
148 0.22
149 0.24
150 0.25
151 0.26
152 0.33
153 0.43
154 0.51
155 0.51
156 0.56
157 0.58
158 0.6
159 0.62
160 0.55
161 0.45
162 0.38
163 0.33
164 0.27
165 0.25
166 0.25