Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VB84

Protein Details
Accession A0A1D2VB84    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
165-188NIKLGKPKFKCELWKKRWKDGWDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.333, mito_nucl 8.833, cyto 8.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039799  ALR/ERV  
IPR036774  ERV/ALR_sulphydryl_oxid_sf  
IPR017905  ERV/ALR_sulphydryl_oxidase  
Gene Ontology GO:0016971  F:flavin-linked sulfhydryl oxidase activity  
Pfam View protein in Pfam  
PF04777  Evr1_Alr  
PROSITE View protein in PROSITE  
PS51324  ERV_ALR  
Amino Acid Sequences MTQEVQERQDSKPVYGSSGRKIIYDENGKPCRTCNTLLDFQMATHGTKVNIPTPKPSLAIPNDSPKEASKSADSPYPYQKEYPPDVTKLGNHSWTLLHTIAAAYPEKPSIEQQNEMKTFLNIFAKIYPCWYCGKDFQSFIKKNEPKVMTQDDFGKWLCNAHNSVNIKLGKPKFKCELWKKRWKDGWDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.4
4 0.38
5 0.43
6 0.41
7 0.35
8 0.37
9 0.35
10 0.36
11 0.41
12 0.41
13 0.45
14 0.5
15 0.5
16 0.49
17 0.47
18 0.45
19 0.41
20 0.38
21 0.33
22 0.35
23 0.4
24 0.41
25 0.42
26 0.36
27 0.32
28 0.32
29 0.28
30 0.2
31 0.16
32 0.16
33 0.13
34 0.15
35 0.18
36 0.19
37 0.24
38 0.24
39 0.27
40 0.3
41 0.31
42 0.3
43 0.29
44 0.3
45 0.28
46 0.33
47 0.31
48 0.36
49 0.36
50 0.35
51 0.36
52 0.3
53 0.32
54 0.26
55 0.25
56 0.19
57 0.2
58 0.21
59 0.23
60 0.24
61 0.22
62 0.28
63 0.3
64 0.28
65 0.28
66 0.29
67 0.31
68 0.33
69 0.37
70 0.32
71 0.3
72 0.31
73 0.3
74 0.28
75 0.27
76 0.25
77 0.2
78 0.18
79 0.16
80 0.15
81 0.15
82 0.16
83 0.12
84 0.1
85 0.08
86 0.08
87 0.08
88 0.09
89 0.09
90 0.06
91 0.07
92 0.07
93 0.08
94 0.08
95 0.1
96 0.15
97 0.18
98 0.21
99 0.24
100 0.31
101 0.32
102 0.32
103 0.31
104 0.24
105 0.22
106 0.21
107 0.21
108 0.13
109 0.13
110 0.15
111 0.16
112 0.16
113 0.19
114 0.17
115 0.16
116 0.2
117 0.2
118 0.2
119 0.24
120 0.28
121 0.29
122 0.3
123 0.35
124 0.43
125 0.45
126 0.46
127 0.52
128 0.51
129 0.51
130 0.57
131 0.52
132 0.44
133 0.47
134 0.52
135 0.43
136 0.41
137 0.43
138 0.34
139 0.35
140 0.32
141 0.27
142 0.2
143 0.21
144 0.21
145 0.2
146 0.22
147 0.22
148 0.3
149 0.31
150 0.32
151 0.37
152 0.37
153 0.35
154 0.41
155 0.45
156 0.47
157 0.47
158 0.52
159 0.51
160 0.56
161 0.65
162 0.67
163 0.72
164 0.72
165 0.8
166 0.8
167 0.84
168 0.86