Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GA97

Protein Details
Accession C1GA97    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-68RSRTPPLSSKKGKIKRRNNTQPPSNRVAHydrophilic
98-121SELPAWKARHKPQHKKTPKAANFYHydrophilic
NLS Segment(s)
PositionSequence
49-57SKKGKIKRR
105-116ARHKPQHKKTPK
Subcellular Location(s) mito 11, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR018266  Ribosomal_L35Ae_CS  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbn:PADG_04183  -  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
PROSITE View protein in PROSITE  
PS01105  RIBOSOMAL_L35AE  
Amino Acid Sequences MPNRSNTHQTNQQPAEKGLGFDFDFKTTTSNEQRATNADQRSRTPPLSSKKGKIKRRNNTQPPSNRVAVFSSPFPPFDLQSFGGPPCLPITVTDGSASELPAWKARHKPQHKKTPKAANFYLGKKVAFVYRAKREVQGSKIRVIWGKVTRTHGNSGVVRAQFRHNLPPKTFGATVRVMLYPSSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.44
4 0.4
5 0.3
6 0.28
7 0.23
8 0.23
9 0.23
10 0.19
11 0.19
12 0.18
13 0.19
14 0.17
15 0.24
16 0.27
17 0.3
18 0.32
19 0.33
20 0.35
21 0.37
22 0.42
23 0.41
24 0.41
25 0.4
26 0.41
27 0.42
28 0.46
29 0.48
30 0.42
31 0.39
32 0.41
33 0.45
34 0.52
35 0.54
36 0.56
37 0.62
38 0.7
39 0.76
40 0.79
41 0.82
42 0.82
43 0.87
44 0.9
45 0.9
46 0.9
47 0.89
48 0.87
49 0.83
50 0.77
51 0.69
52 0.58
53 0.49
54 0.43
55 0.35
56 0.28
57 0.23
58 0.21
59 0.19
60 0.18
61 0.19
62 0.17
63 0.15
64 0.14
65 0.16
66 0.14
67 0.14
68 0.15
69 0.13
70 0.14
71 0.13
72 0.12
73 0.09
74 0.08
75 0.07
76 0.07
77 0.11
78 0.1
79 0.11
80 0.11
81 0.1
82 0.11
83 0.11
84 0.1
85 0.07
86 0.07
87 0.08
88 0.12
89 0.13
90 0.16
91 0.22
92 0.29
93 0.4
94 0.49
95 0.59
96 0.65
97 0.75
98 0.81
99 0.83
100 0.85
101 0.85
102 0.81
103 0.78
104 0.69
105 0.65
106 0.61
107 0.55
108 0.53
109 0.43
110 0.37
111 0.29
112 0.29
113 0.24
114 0.23
115 0.24
116 0.25
117 0.32
118 0.36
119 0.36
120 0.39
121 0.42
122 0.43
123 0.47
124 0.49
125 0.44
126 0.43
127 0.44
128 0.43
129 0.41
130 0.37
131 0.37
132 0.34
133 0.36
134 0.37
135 0.42
136 0.45
137 0.46
138 0.48
139 0.44
140 0.44
141 0.41
142 0.4
143 0.39
144 0.35
145 0.33
146 0.31
147 0.33
148 0.33
149 0.34
150 0.41
151 0.44
152 0.49
153 0.51
154 0.55
155 0.52
156 0.52
157 0.51
158 0.43
159 0.39
160 0.34
161 0.34
162 0.3
163 0.29
164 0.23