Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1G6T0

Protein Details
Accession C1G6T0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
84-108GGEVRREKGRRRRWKKEGAGRGLYRBasic
NLS Segment(s)
PositionSequence
87-104VRREKGRRRRWKKEGAGR
Subcellular Location(s) nucl 10, cyto 10, cyto_nucl 10
Family & Domain DBs
KEGG pbn:PADG_02885  -  
Amino Acid Sequences MKNPVPERTARPGAHPVRPPVEKGSETVQRITEGPAVPGSGRERRNGDTSAVGGCWRTNKPCGKEKTARGGAIGTPGEGSGFGGGEVRREKGRRRRWKKEGAGRGLYRLLIALIANWRGEEGGQTRTGDASPDWEGASGATAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.55
4 0.54
5 0.55
6 0.53
7 0.48
8 0.48
9 0.41
10 0.37
11 0.38
12 0.38
13 0.38
14 0.37
15 0.33
16 0.28
17 0.28
18 0.28
19 0.26
20 0.19
21 0.18
22 0.16
23 0.16
24 0.15
25 0.17
26 0.19
27 0.21
28 0.22
29 0.25
30 0.29
31 0.31
32 0.35
33 0.33
34 0.3
35 0.25
36 0.24
37 0.21
38 0.17
39 0.15
40 0.11
41 0.1
42 0.12
43 0.13
44 0.15
45 0.2
46 0.27
47 0.31
48 0.39
49 0.44
50 0.48
51 0.54
52 0.56
53 0.59
54 0.57
55 0.52
56 0.44
57 0.39
58 0.31
59 0.27
60 0.23
61 0.13
62 0.08
63 0.08
64 0.08
65 0.06
66 0.06
67 0.03
68 0.03
69 0.03
70 0.05
71 0.05
72 0.08
73 0.09
74 0.11
75 0.14
76 0.17
77 0.26
78 0.35
79 0.46
80 0.55
81 0.64
82 0.73
83 0.79
84 0.88
85 0.89
86 0.89
87 0.88
88 0.85
89 0.83
90 0.73
91 0.67
92 0.57
93 0.47
94 0.36
95 0.26
96 0.18
97 0.1
98 0.09
99 0.08
100 0.09
101 0.1
102 0.1
103 0.1
104 0.1
105 0.1
106 0.1
107 0.12
108 0.11
109 0.14
110 0.16
111 0.17
112 0.17
113 0.18
114 0.18
115 0.17
116 0.15
117 0.15
118 0.15
119 0.16
120 0.16
121 0.15
122 0.15
123 0.13