Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VCJ3

Protein Details
Accession A0A1D2VCJ3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
135-154QTNTKKLKKIPFGNKGIRRLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR000417  Hyethyz_kinase  
IPR029056  Ribokinase-like  
IPR036206  ThiamineP_synth_sf  
IPR022998  ThiamineP_synth_TenI  
IPR034291  TMP_synthase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004417  F:hydroxyethylthiazole kinase activity  
GO:0000287  F:magnesium ion binding  
GO:0004789  F:thiamine-phosphate diphosphorylase activity  
GO:0009228  P:thiamine biosynthetic process  
GO:0009229  P:thiamine diphosphate biosynthetic process  
Pfam View protein in Pfam  
PF02110  HK  
PF02581  TMP-TENI  
CDD cd01170  THZ_kinase  
cd00564  TMP_TenI  
Amino Acid Sequences DYTLYLVTDSGLIPEGLTIYDQVEAALRNGVTIVQLREKTLETKDFIERANKIHELTLKYKVPLIINDRVDVLLACGAEGLHIGQDDMDPIVARKLIGDDKILGLSCSKETEIERVIDNLEECKIDYIGIGAVFQTNTKKLKKIPFGNKGIRRLLLKLRDYKNGIGKDIKSVIIGGLNKSNIQGVLYTSSVPGKATDGVAVVSCIMGEKDAGKATTDTLDSIQKAGPWYKNIDNGENNSDFKLVPTDKSILNVQRLNPLVHHITNEVVTNFSANVTIAIGGSPIMSQLAGDFKDLKKIPNAGFLLNAGTITEITIPIQIAAIKEYNSYGVPVILDPVGCGATAARKEYMKKLLNSGHYFSVIKGNSGEILTASDIGLGVEMKGCDAIENEDNKENLIKAAKKLALEQRCVVVVSGKEDIIVDGVMEGRDINLAEYNPNTLIQRAVKIVGGHELMGKITGSGCSLGSTITTFVAARQALDTFSSVVNAVRLYNEAGYRAGIVSKGPGSFMSNFIDELYLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.08
6 0.07
7 0.08
8 0.08
9 0.08
10 0.1
11 0.1
12 0.1
13 0.13
14 0.12
15 0.11
16 0.12
17 0.12
18 0.12
19 0.15
20 0.18
21 0.22
22 0.23
23 0.24
24 0.27
25 0.28
26 0.31
27 0.33
28 0.34
29 0.3
30 0.33
31 0.37
32 0.38
33 0.39
34 0.42
35 0.38
36 0.37
37 0.4
38 0.38
39 0.34
40 0.36
41 0.38
42 0.37
43 0.39
44 0.44
45 0.41
46 0.39
47 0.41
48 0.41
49 0.37
50 0.38
51 0.4
52 0.4
53 0.39
54 0.39
55 0.36
56 0.33
57 0.3
58 0.23
59 0.18
60 0.11
61 0.09
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.06
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.08
79 0.08
80 0.08
81 0.08
82 0.11
83 0.14
84 0.16
85 0.17
86 0.17
87 0.17
88 0.19
89 0.19
90 0.16
91 0.13
92 0.13
93 0.12
94 0.13
95 0.12
96 0.13
97 0.14
98 0.18
99 0.2
100 0.2
101 0.2
102 0.19
103 0.19
104 0.18
105 0.17
106 0.14
107 0.12
108 0.11
109 0.11
110 0.11
111 0.1
112 0.09
113 0.08
114 0.08
115 0.08
116 0.07
117 0.07
118 0.06
119 0.07
120 0.07
121 0.08
122 0.1
123 0.13
124 0.19
125 0.22
126 0.26
127 0.32
128 0.41
129 0.49
130 0.57
131 0.63
132 0.67
133 0.74
134 0.8
135 0.8
136 0.78
137 0.72
138 0.65
139 0.56
140 0.5
141 0.49
142 0.48
143 0.46
144 0.49
145 0.49
146 0.53
147 0.54
148 0.54
149 0.54
150 0.48
151 0.45
152 0.41
153 0.37
154 0.35
155 0.34
156 0.29
157 0.22
158 0.2
159 0.17
160 0.16
161 0.16
162 0.13
163 0.14
164 0.15
165 0.15
166 0.15
167 0.15
168 0.11
169 0.1
170 0.09
171 0.07
172 0.09
173 0.09
174 0.09
175 0.09
176 0.1
177 0.1
178 0.1
179 0.09
180 0.08
181 0.09
182 0.09
183 0.08
184 0.08
185 0.08
186 0.08
187 0.07
188 0.06
189 0.05
190 0.04
191 0.04
192 0.03
193 0.03
194 0.03
195 0.04
196 0.05
197 0.07
198 0.07
199 0.08
200 0.08
201 0.09
202 0.1
203 0.1
204 0.09
205 0.09
206 0.12
207 0.11
208 0.12
209 0.12
210 0.11
211 0.13
212 0.16
213 0.17
214 0.16
215 0.2
216 0.21
217 0.27
218 0.27
219 0.3
220 0.28
221 0.29
222 0.31
223 0.29
224 0.27
225 0.22
226 0.21
227 0.16
228 0.14
229 0.17
230 0.13
231 0.12
232 0.14
233 0.15
234 0.15
235 0.16
236 0.2
237 0.18
238 0.22
239 0.23
240 0.21
241 0.24
242 0.26
243 0.24
244 0.21
245 0.21
246 0.19
247 0.18
248 0.17
249 0.13
250 0.12
251 0.12
252 0.13
253 0.1
254 0.08
255 0.07
256 0.07
257 0.06
258 0.06
259 0.05
260 0.05
261 0.05
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.03
268 0.03
269 0.03
270 0.03
271 0.03
272 0.03
273 0.03
274 0.03
275 0.05
276 0.06
277 0.06
278 0.09
279 0.09
280 0.16
281 0.17
282 0.18
283 0.19
284 0.24
285 0.24
286 0.29
287 0.3
288 0.23
289 0.23
290 0.22
291 0.2
292 0.15
293 0.14
294 0.07
295 0.06
296 0.05
297 0.05
298 0.05
299 0.04
300 0.04
301 0.05
302 0.05
303 0.05
304 0.05
305 0.06
306 0.06
307 0.08
308 0.08
309 0.08
310 0.08
311 0.08
312 0.09
313 0.08
314 0.09
315 0.07
316 0.07
317 0.07
318 0.06
319 0.07
320 0.07
321 0.06
322 0.05
323 0.06
324 0.06
325 0.05
326 0.05
327 0.04
328 0.08
329 0.09
330 0.11
331 0.13
332 0.15
333 0.17
334 0.22
335 0.31
336 0.33
337 0.33
338 0.38
339 0.42
340 0.47
341 0.49
342 0.46
343 0.38
344 0.35
345 0.34
346 0.29
347 0.3
348 0.23
349 0.2
350 0.18
351 0.17
352 0.16
353 0.15
354 0.14
355 0.07
356 0.08
357 0.08
358 0.08
359 0.07
360 0.06
361 0.06
362 0.05
363 0.06
364 0.04
365 0.04
366 0.05
367 0.05
368 0.05
369 0.06
370 0.06
371 0.06
372 0.06
373 0.1
374 0.14
375 0.16
376 0.19
377 0.22
378 0.22
379 0.22
380 0.23
381 0.19
382 0.17
383 0.21
384 0.21
385 0.2
386 0.27
387 0.29
388 0.28
389 0.34
390 0.41
391 0.41
392 0.42
393 0.41
394 0.36
395 0.34
396 0.34
397 0.28
398 0.23
399 0.18
400 0.17
401 0.18
402 0.16
403 0.15
404 0.15
405 0.15
406 0.11
407 0.1
408 0.06
409 0.05
410 0.06
411 0.06
412 0.06
413 0.05
414 0.05
415 0.06
416 0.06
417 0.07
418 0.08
419 0.09
420 0.11
421 0.11
422 0.13
423 0.13
424 0.15
425 0.15
426 0.13
427 0.17
428 0.17
429 0.19
430 0.19
431 0.19
432 0.2
433 0.2
434 0.2
435 0.2
436 0.19
437 0.17
438 0.17
439 0.16
440 0.14
441 0.14
442 0.13
443 0.09
444 0.09
445 0.09
446 0.08
447 0.09
448 0.09
449 0.09
450 0.09
451 0.09
452 0.09
453 0.09
454 0.09
455 0.08
456 0.09
457 0.08
458 0.09
459 0.14
460 0.14
461 0.14
462 0.14
463 0.15
464 0.14
465 0.16
466 0.16
467 0.12
468 0.12
469 0.12
470 0.12
471 0.12
472 0.12
473 0.11
474 0.11
475 0.1
476 0.12
477 0.13
478 0.15
479 0.16
480 0.16
481 0.16
482 0.16
483 0.16
484 0.15
485 0.14
486 0.12
487 0.11
488 0.14
489 0.16
490 0.16
491 0.15
492 0.16
493 0.2
494 0.21
495 0.23
496 0.23
497 0.21
498 0.21
499 0.21
500 0.21