Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T2A7

Protein Details
Accession A0A1E4T2A7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-45LTKPQPFKASIHKNKKRHKPQRQILNDEFKRHydrophilic
NLS Segment(s)
PositionSequence
25-34IHKNKKRHKP
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MGSTDIDLVAISDKLTKPQPFKASIHKNKKRHKPQRQILNDEFKRVQQKQLESNTHDPNIIYYHSLNAPPSLKPIKKYCDVTGLPSNYKSPHNQLRYYDKECYDIVKHMAPGVDQQYLALRGANVILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.22
3 0.27
4 0.3
5 0.38
6 0.44
7 0.45
8 0.48
9 0.55
10 0.6
11 0.65
12 0.72
13 0.74
14 0.78
15 0.83
16 0.9
17 0.91
18 0.91
19 0.91
20 0.91
21 0.91
22 0.92
23 0.91
24 0.88
25 0.84
26 0.84
27 0.73
28 0.67
29 0.59
30 0.51
31 0.51
32 0.43
33 0.42
34 0.36
35 0.4
36 0.42
37 0.49
38 0.5
39 0.47
40 0.52
41 0.49
42 0.44
43 0.4
44 0.32
45 0.25
46 0.22
47 0.17
48 0.12
49 0.09
50 0.09
51 0.1
52 0.11
53 0.1
54 0.11
55 0.11
56 0.1
57 0.15
58 0.2
59 0.21
60 0.24
61 0.29
62 0.32
63 0.37
64 0.41
65 0.38
66 0.4
67 0.39
68 0.4
69 0.42
70 0.41
71 0.36
72 0.34
73 0.34
74 0.28
75 0.3
76 0.28
77 0.28
78 0.34
79 0.38
80 0.41
81 0.45
82 0.52
83 0.57
84 0.59
85 0.57
86 0.48
87 0.46
88 0.42
89 0.41
90 0.34
91 0.3
92 0.29
93 0.26
94 0.25
95 0.24
96 0.24
97 0.2
98 0.22
99 0.22
100 0.2
101 0.17
102 0.17
103 0.19
104 0.2
105 0.2
106 0.16
107 0.13
108 0.12