Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SW94

Protein Details
Accession A0A1E4SW94    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
218-237LKQGFDKKSKIPKEANKSGYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 7, cyto_nucl 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR006439  HAD-SF_hydro_IA  
IPR041492  HAD_2  
IPR023214  HAD_sf  
Pfam View protein in Pfam  
PF13419  HAD_2  
CDD cd01427  HAD_like  
Amino Acid Sequences MSKSVSVTKRMVLHPLNSKEIPILGIVFDMDGTLTKPQTYMFKEMREALGIVGKPIDILDKLSSITDPEEKEISELKIKKIEEDTMLKMEPQEGLLDMLEFLKSEKLKFTICTRNLIKPVNHLRSTYLPEINFHEPIVTREFIPPKPSPLPLLHIAKSWDIKPENLIMVGDSRDDMYAGLNAGFSMVLLKHDDNGHLVDEIPDIDFVVQNYHQFVEILKQGFDKKSKIPKEANKSGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.53
4 0.48
5 0.46
6 0.39
7 0.36
8 0.3
9 0.21
10 0.16
11 0.09
12 0.09
13 0.09
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.06
20 0.08
21 0.09
22 0.09
23 0.09
24 0.11
25 0.18
26 0.22
27 0.28
28 0.3
29 0.32
30 0.35
31 0.37
32 0.37
33 0.31
34 0.28
35 0.2
36 0.21
37 0.18
38 0.16
39 0.14
40 0.12
41 0.1
42 0.1
43 0.11
44 0.06
45 0.08
46 0.09
47 0.09
48 0.1
49 0.11
50 0.11
51 0.1
52 0.12
53 0.13
54 0.13
55 0.15
56 0.15
57 0.15
58 0.16
59 0.18
60 0.18
61 0.21
62 0.23
63 0.22
64 0.27
65 0.27
66 0.28
67 0.28
68 0.28
69 0.25
70 0.27
71 0.27
72 0.24
73 0.24
74 0.22
75 0.19
76 0.18
77 0.14
78 0.1
79 0.08
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.07
90 0.08
91 0.08
92 0.1
93 0.11
94 0.12
95 0.14
96 0.2
97 0.26
98 0.27
99 0.34
100 0.35
101 0.37
102 0.4
103 0.42
104 0.37
105 0.36
106 0.43
107 0.43
108 0.41
109 0.37
110 0.36
111 0.35
112 0.39
113 0.34
114 0.28
115 0.22
116 0.22
117 0.26
118 0.26
119 0.24
120 0.19
121 0.17
122 0.14
123 0.16
124 0.18
125 0.14
126 0.12
127 0.16
128 0.19
129 0.19
130 0.25
131 0.23
132 0.26
133 0.28
134 0.28
135 0.27
136 0.25
137 0.29
138 0.29
139 0.33
140 0.28
141 0.28
142 0.28
143 0.28
144 0.28
145 0.24
146 0.25
147 0.21
148 0.21
149 0.21
150 0.22
151 0.2
152 0.18
153 0.17
154 0.11
155 0.11
156 0.11
157 0.1
158 0.08
159 0.08
160 0.07
161 0.07
162 0.07
163 0.06
164 0.06
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.05
171 0.04
172 0.05
173 0.05
174 0.06
175 0.09
176 0.09
177 0.12
178 0.13
179 0.14
180 0.14
181 0.15
182 0.15
183 0.13
184 0.13
185 0.11
186 0.11
187 0.11
188 0.09
189 0.08
190 0.07
191 0.07
192 0.08
193 0.08
194 0.11
195 0.12
196 0.13
197 0.14
198 0.15
199 0.15
200 0.14
201 0.14
202 0.15
203 0.19
204 0.2
205 0.19
206 0.22
207 0.26
208 0.31
209 0.35
210 0.35
211 0.38
212 0.47
213 0.54
214 0.59
215 0.65
216 0.69
217 0.75