Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SZH2

Protein Details
Accession A0A1E4SZH2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-170TSESSTTKKKSNRNKKKYSLADLDAKHydrophilic
NLS Segment(s)
PositionSequence
157-159RNK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015362  WIBG_mago-bd  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MAMSAEIRTEGGTLRSDGSVRKVVKIKPGFVRDDDVERYDVSKRRAQRQHEAKSKTDSVESRDDLSELTSKLKISDEPTRTRVAGVEKIKRLEKSDSKSSSSTKTREYDDTLHEAGEIKTAPSFKTDELKSSLEAGKIDSSPSMTSESSTTKKKSNRNKKKYSLADLDAKYGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.17
5 0.2
6 0.26
7 0.26
8 0.31
9 0.35
10 0.37
11 0.46
12 0.5
13 0.51
14 0.52
15 0.57
16 0.54
17 0.5
18 0.53
19 0.45
20 0.45
21 0.41
22 0.34
23 0.29
24 0.26
25 0.25
26 0.26
27 0.28
28 0.28
29 0.31
30 0.34
31 0.44
32 0.51
33 0.56
34 0.61
35 0.66
36 0.72
37 0.76
38 0.75
39 0.68
40 0.66
41 0.63
42 0.53
43 0.47
44 0.39
45 0.34
46 0.35
47 0.33
48 0.29
49 0.26
50 0.25
51 0.2
52 0.2
53 0.18
54 0.12
55 0.13
56 0.12
57 0.11
58 0.12
59 0.13
60 0.13
61 0.15
62 0.22
63 0.25
64 0.29
65 0.31
66 0.32
67 0.32
68 0.3
69 0.28
70 0.23
71 0.25
72 0.26
73 0.29
74 0.3
75 0.32
76 0.35
77 0.34
78 0.33
79 0.33
80 0.34
81 0.35
82 0.42
83 0.42
84 0.43
85 0.44
86 0.43
87 0.43
88 0.43
89 0.39
90 0.35
91 0.34
92 0.34
93 0.35
94 0.37
95 0.33
96 0.31
97 0.33
98 0.29
99 0.26
100 0.23
101 0.21
102 0.17
103 0.16
104 0.12
105 0.08
106 0.09
107 0.1
108 0.1
109 0.11
110 0.13
111 0.12
112 0.2
113 0.2
114 0.22
115 0.26
116 0.27
117 0.26
118 0.28
119 0.28
120 0.22
121 0.22
122 0.2
123 0.18
124 0.17
125 0.17
126 0.14
127 0.14
128 0.13
129 0.14
130 0.15
131 0.13
132 0.14
133 0.16
134 0.21
135 0.24
136 0.3
137 0.32
138 0.36
139 0.44
140 0.53
141 0.61
142 0.67
143 0.74
144 0.79
145 0.86
146 0.88
147 0.91
148 0.91
149 0.89
150 0.86
151 0.8
152 0.78
153 0.69