Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4STW2

Protein Details
Accession A0A1E4STW2   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
113-133TSTYNVKKSNSKNKKGICSYCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MTHQLTPEEIQSKFTELNLKISTLAELVSNKEHKFNTEKLKYESMLNDISNSVTKLNNSRKTSQDVESGMVLVDAEQLSNLVELVNSIRSQSMEVNDKSIPSTNTSTTPPPTTSTYNVKKSNSKNKKGICSYCSQIGHKRSECPLKLYGETNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.25
4 0.32
5 0.29
6 0.29
7 0.27
8 0.26
9 0.25
10 0.17
11 0.16
12 0.11
13 0.11
14 0.12
15 0.17
16 0.21
17 0.2
18 0.25
19 0.25
20 0.26
21 0.31
22 0.35
23 0.4
24 0.43
25 0.47
26 0.47
27 0.51
28 0.48
29 0.46
30 0.4
31 0.33
32 0.29
33 0.25
34 0.21
35 0.17
36 0.17
37 0.15
38 0.14
39 0.12
40 0.09
41 0.11
42 0.18
43 0.27
44 0.35
45 0.38
46 0.41
47 0.43
48 0.48
49 0.5
50 0.44
51 0.39
52 0.32
53 0.29
54 0.25
55 0.22
56 0.16
57 0.13
58 0.1
59 0.05
60 0.05
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.02
69 0.02
70 0.03
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.08
78 0.09
79 0.11
80 0.16
81 0.16
82 0.19
83 0.19
84 0.19
85 0.19
86 0.2
87 0.18
88 0.16
89 0.18
90 0.17
91 0.19
92 0.22
93 0.24
94 0.24
95 0.26
96 0.24
97 0.24
98 0.26
99 0.27
100 0.29
101 0.36
102 0.41
103 0.47
104 0.51
105 0.52
106 0.56
107 0.62
108 0.69
109 0.7
110 0.71
111 0.72
112 0.74
113 0.8
114 0.81
115 0.79
116 0.71
117 0.67
118 0.62
119 0.61
120 0.58
121 0.53
122 0.52
123 0.52
124 0.57
125 0.53
126 0.55
127 0.55
128 0.6
129 0.58
130 0.55
131 0.54
132 0.49
133 0.5