Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4T6J7

Protein Details
Accession A0A1E4T6J7    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-27GEEKEKPQEKPQEKKEEKKDHHHVKDBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 11.833, cyto 10.5, mito_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MGEEKEKPQEKPQEKKEEKKDHHHVKDGVKRFGNAVTFGAGASIGNKIVDSIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.84
4 0.84
5 0.81
6 0.81
7 0.82
8 0.81
9 0.79
10 0.76
11 0.7
12 0.67
13 0.69
14 0.65
15 0.6
16 0.5
17 0.46
18 0.4
19 0.37
20 0.31
21 0.23
22 0.18
23 0.14
24 0.13
25 0.12
26 0.11
27 0.08
28 0.07
29 0.06
30 0.07
31 0.06
32 0.06
33 0.06