Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SZD7

Protein Details
Accession A0A1E4SZD7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-50NNKYNRYQGCNKHKRYRRQIPLHRLNNYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MQQPVQRYNNILHRPHINKSWRNNKYNRYQGCNKHKRYRRQIPLHRLNNYQYNTYNSYNGRLHRVRNSNYRQHHLMSNKEIHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.56
4 0.56
5 0.55
6 0.63
7 0.7
8 0.69
9 0.73
10 0.76
11 0.75
12 0.76
13 0.78
14 0.73
15 0.7
16 0.7
17 0.72
18 0.75
19 0.78
20 0.76
21 0.76
22 0.79
23 0.82
24 0.84
25 0.85
26 0.84
27 0.84
28 0.86
29 0.86
30 0.89
31 0.85
32 0.78
33 0.7
34 0.63
35 0.6
36 0.52
37 0.44
38 0.35
39 0.32
40 0.34
41 0.32
42 0.33
43 0.26
44 0.3
45 0.31
46 0.31
47 0.35
48 0.33
49 0.36
50 0.41
51 0.49
52 0.5
53 0.57
54 0.63
55 0.64
56 0.68
57 0.71
58 0.65
59 0.6
60 0.62
61 0.58
62 0.57
63 0.55