Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T857

Protein Details
Accession A0A1E4T857   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-79VYQLTNKQTAQKNKKNKTRQLKDVHNSTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 5, mito 3, pero 2
Family & Domain DBs
Amino Acid Sequences MESNGNFHINSTQFEFEFEFDCCYIYIISYNNIIKSYIYILINTTTTTSPVYQLTNKQTAQKNKKNKTRQLKDVHNSTCFQNGKIRIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.19
4 0.19
5 0.17
6 0.15
7 0.13
8 0.14
9 0.12
10 0.11
11 0.1
12 0.09
13 0.1
14 0.09
15 0.1
16 0.13
17 0.14
18 0.14
19 0.15
20 0.14
21 0.13
22 0.12
23 0.13
24 0.12
25 0.11
26 0.11
27 0.11
28 0.11
29 0.12
30 0.11
31 0.11
32 0.07
33 0.08
34 0.09
35 0.08
36 0.09
37 0.1
38 0.12
39 0.13
40 0.18
41 0.22
42 0.27
43 0.27
44 0.33
45 0.39
46 0.48
47 0.56
48 0.6
49 0.66
50 0.71
51 0.8
52 0.83
53 0.86
54 0.87
55 0.86
56 0.87
57 0.86
58 0.87
59 0.84
60 0.84
61 0.79
62 0.71
63 0.64
64 0.56
65 0.55
66 0.46
67 0.4
68 0.38